BLASTX nr result
ID: Rehmannia27_contig00019477
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00019477 (738 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012829767.1| PREDICTED: hexokinase-1-like [Erythranthe gu... 55 3e-06 >ref|XP_012829767.1| PREDICTED: hexokinase-1-like [Erythranthe guttata] gi|604347680|gb|EYU45835.1| hypothetical protein MIMGU_mgv1a005054mg [Erythranthe guttata] Length = 498 Score = 55.5 bits (132), Expect(2) = 3e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -3 Query: 256 ALSGYITAKSANSVAEEEQIFHQPSGSRMEI*FIFLFPLIQTSL 125 AL YI K AN VAEEEQIFHQP G + E+ F F FP++QTS+ Sbjct: 142 ALFDYIAEKLANFVAEEEQIFHQPPGKQRELGFTFSFPVMQTSI 185 Score = 23.5 bits (49), Expect(2) = 3e-06 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 105 WTKGFSIED 79 WTKGFSI+D Sbjct: 193 WTKGFSIDD 201