BLASTX nr result
ID: Rehmannia27_contig00019208
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00019208 (619 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097572.1| PREDICTED: transmembrane protein 50 homolog ... 118 1e-30 ref|XP_012853511.1| PREDICTED: transmembrane protein 50A-like [E... 116 6e-30 ref|XP_011074884.1| PREDICTED: transmembrane protein 50 homolog ... 115 2e-29 gb|EPS68809.1| hypothetical protein M569_05961 [Genlisea aurea] 115 2e-29 ref|XP_012854743.1| PREDICTED: transmembrane protein 50 homolog ... 112 1e-28 ref|XP_010671732.1| PREDICTED: transmembrane protein 50 homolog ... 112 1e-28 ref|XP_006472700.1| PREDICTED: transmembrane protein 50 homolog ... 112 1e-28 ref|XP_006434104.1| hypothetical protein CICLE_v10002818mg [Citr... 112 1e-28 ref|XP_009589362.1| PREDICTED: transmembrane protein 50 homolog ... 112 3e-28 ref|XP_006364964.1| PREDICTED: transmembrane protein 50 homolog ... 112 3e-28 ref|XP_010538966.1| PREDICTED: transmembrane protein 50 homolog ... 110 8e-28 ref|XP_008460472.1| PREDICTED: transmembrane protein 50 homolog ... 110 1e-27 ref|XP_012452246.1| PREDICTED: transmembrane protein 50A isoform... 110 1e-27 ref|XP_012452245.1| PREDICTED: transmembrane protein 50 homolog ... 110 2e-27 ref|XP_010064004.1| PREDICTED: transmembrane protein 50 homolog ... 110 2e-27 gb|KNA12878.1| hypothetical protein SOVF_121180 [Spinacia oleracea] 109 2e-27 ref|XP_011027625.1| PREDICTED: transmembrane protein 50A-like [P... 109 2e-27 ref|NP_001295740.1| transmembrane protein 50A [Jatropha curcas] ... 109 2e-27 ref|XP_002302262.1| hypothetical protein POPTR_0002s08980g [Popu... 109 2e-27 ref|XP_015571620.1| PREDICTED: transmembrane protein 50A [Ricinu... 108 4e-27 >ref|XP_011097572.1| PREDICTED: transmembrane protein 50 homolog [Sesamum indicum] Length = 135 Score = 118 bits (295), Expect = 1e-30 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLFIAYVVSFVSLAASVGLLIQDALVE+GPSAWTGVAGVLQCVFVLISGLIYWISHSE Sbjct: 77 LWLFIAYVVSFVSLAASVGLLIQDALVESGPSAWTGVAGVLQCVFVLISGLIYWISHSE 135 >ref|XP_012853511.1| PREDICTED: transmembrane protein 50A-like [Erythranthe guttata] Length = 135 Score = 116 bits (290), Expect = 6e-30 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLFIAYVVSFVSLAASVGLLIQDALVE+GPSAW GVAGVLQCVFVLISGLIYWISHSE Sbjct: 77 LWLFIAYVVSFVSLAASVGLLIQDALVESGPSAWAGVAGVLQCVFVLISGLIYWISHSE 135 >ref|XP_011074884.1| PREDICTED: transmembrane protein 50 homolog [Sesamum indicum] Length = 135 Score = 115 bits (287), Expect = 2e-29 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLFIAYVVSFVSLAASVGLLIQD LV++GPSAWTGVAGVLQCVFVLISGLIYWISHSE Sbjct: 77 LWLFIAYVVSFVSLAASVGLLIQDTLVKSGPSAWTGVAGVLQCVFVLISGLIYWISHSE 135 >gb|EPS68809.1| hypothetical protein M569_05961 [Genlisea aurea] Length = 135 Score = 115 bits (287), Expect = 2e-29 Identities = 55/59 (93%), Positives = 59/59 (100%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLFIAYVVSFVSLAASVGLL+QDA+V++GPSAWTGVAGVLQCVFVLISGLIYWISHSE Sbjct: 77 LWLFIAYVVSFVSLAASVGLLVQDAVVKSGPSAWTGVAGVLQCVFVLISGLIYWISHSE 135 >ref|XP_012854743.1| PREDICTED: transmembrane protein 50 homolog [Erythranthe guttata] Length = 135 Score = 112 bits (281), Expect = 1e-28 Identities = 52/59 (88%), Positives = 58/59 (98%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLFIAYVVSFVSLAASVGLL+QD++V TGPS+WTGVAGVLQCVF+LISGLIYW+SHSE Sbjct: 77 LWLFIAYVVSFVSLAASVGLLVQDSVVATGPSSWTGVAGVLQCVFILISGLIYWVSHSE 135 >ref|XP_010671732.1| PREDICTED: transmembrane protein 50 homolog isoform X1 [Beta vulgaris subsp. vulgaris] gi|870869278|gb|KMT20023.1| hypothetical protein BVRB_1g000430 [Beta vulgaris subsp. vulgaris] Length = 135 Score = 112 bits (281), Expect = 1e-28 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLF+AYV+SFVSLAASVGLLIQDALV TGPSAWTG AGVLQCVFVLISGLIYW SHSE Sbjct: 77 LWLFLAYVISFVSLAASVGLLIQDALVPTGPSAWTGTAGVLQCVFVLISGLIYWTSHSE 135 >ref|XP_006472700.1| PREDICTED: transmembrane protein 50 homolog [Citrus sinensis] gi|641862119|gb|KDO80806.1| hypothetical protein CISIN_1g032718mg [Citrus sinensis] Length = 135 Score = 112 bits (281), Expect = 1e-28 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLF+AYVVSFVSLAASVGLLIQD+LV+TGPSAWTG AGVLQCVFVLISGLIYW SHSE Sbjct: 77 LWLFLAYVVSFVSLAASVGLLIQDSLVKTGPSAWTGTAGVLQCVFVLISGLIYWTSHSE 135 >ref|XP_006434104.1| hypothetical protein CICLE_v10002818mg [Citrus clementina] gi|557536226|gb|ESR47344.1| hypothetical protein CICLE_v10002818mg [Citrus clementina] Length = 135 Score = 112 bits (281), Expect = 1e-28 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLF+AYVVSFVSLAASVGLLIQD+LV+TGPSAWTG AGVLQCVFVLISGLIYW SHSE Sbjct: 77 LWLFLAYVVSFVSLAASVGLLIQDSLVKTGPSAWTGTAGVLQCVFVLISGLIYWTSHSE 135 >ref|XP_009589362.1| PREDICTED: transmembrane protein 50 homolog [Nicotiana tomentosiformis] gi|698542271|ref|XP_009766347.1| PREDICTED: transmembrane protein 50 homolog [Nicotiana sylvestris] Length = 136 Score = 112 bits (279), Expect = 3e-28 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLFIAYVVSFVSLAASVGLLIQDAL ++GPSAWTGVAGVLQCVFVLISGLIYW SHSE Sbjct: 77 LWLFIAYVVSFVSLAASVGLLIQDALGKSGPSAWTGVAGVLQCVFVLISGLIYWTSHSE 135 >ref|XP_006364964.1| PREDICTED: transmembrane protein 50 homolog [Solanum tuberosum] Length = 136 Score = 112 bits (279), Expect = 3e-28 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLFIAYVVSFVSLAASVGLLIQDAL ++GPSAWTGVAGVLQCVFVLISGLIYW SHSE Sbjct: 77 LWLFIAYVVSFVSLAASVGLLIQDALGKSGPSAWTGVAGVLQCVFVLISGLIYWTSHSE 135 >ref|XP_010538966.1| PREDICTED: transmembrane protein 50 homolog [Tarenaya hassleriana] Length = 135 Score = 110 bits (276), Expect = 8e-28 Identities = 52/59 (88%), Positives = 57/59 (96%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLFIAYVV+FVSLAASVGLLIQD+LV+TGPSAWTGVAG+ QCVFVLISGL+YW SHSE Sbjct: 77 LWLFIAYVVAFVSLAASVGLLIQDSLVKTGPSAWTGVAGIFQCVFVLISGLMYWTSHSE 135 >ref|XP_008460472.1| PREDICTED: transmembrane protein 50 homolog [Cucumis melo] Length = 135 Score = 110 bits (275), Expect = 1e-27 Identities = 52/59 (88%), Positives = 56/59 (94%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLF AYVVSFVSLAASVGLLIQD++V+TGPS WTGVAGVLQCVFVL+SGLIYW SHSE Sbjct: 77 LWLFFAYVVSFVSLAASVGLLIQDSVVKTGPSVWTGVAGVLQCVFVLVSGLIYWTSHSE 135 >ref|XP_012452246.1| PREDICTED: transmembrane protein 50A isoform X2 [Gossypium raimondii] gi|763797436|gb|KJB64391.1| hypothetical protein B456_010G047100 [Gossypium raimondii] Length = 129 Score = 110 bits (274), Expect = 1e-27 Identities = 52/59 (88%), Positives = 56/59 (94%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLF+AYVVSFVSLAASVGLLIQD+LV++GPS WTG AGVLQCVFVLISGLIYW SHSE Sbjct: 71 LWLFVAYVVSFVSLAASVGLLIQDSLVKSGPSVWTGTAGVLQCVFVLISGLIYWTSHSE 129 >ref|XP_012452245.1| PREDICTED: transmembrane protein 50 homolog isoform X1 [Gossypium raimondii] gi|763797434|gb|KJB64389.1| hypothetical protein B456_010G047100 [Gossypium raimondii] gi|763797435|gb|KJB64390.1| hypothetical protein B456_010G047100 [Gossypium raimondii] Length = 135 Score = 110 bits (274), Expect = 2e-27 Identities = 52/59 (88%), Positives = 56/59 (94%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLF+AYVVSFVSLAASVGLLIQD+LV++GPS WTG AGVLQCVFVLISGLIYW SHSE Sbjct: 77 LWLFVAYVVSFVSLAASVGLLIQDSLVKSGPSVWTGTAGVLQCVFVLISGLIYWTSHSE 135 >ref|XP_010064004.1| PREDICTED: transmembrane protein 50 homolog [Eucalyptus grandis] Length = 135 Score = 110 bits (274), Expect = 2e-27 Identities = 53/59 (89%), Positives = 55/59 (93%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLF AYVVSFVSLAASVGLLIQD+LV TGPS WTGVAGVLQCVFVLISGLIYW +HSE Sbjct: 77 LWLFFAYVVSFVSLAASVGLLIQDSLVTTGPSVWTGVAGVLQCVFVLISGLIYWTAHSE 135 >gb|KNA12878.1| hypothetical protein SOVF_121180 [Spinacia oleracea] Length = 135 Score = 109 bits (273), Expect = 2e-27 Identities = 52/59 (88%), Positives = 56/59 (94%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLF+AYVVSFVSLAASVGLLIQDA++ +GPS WTGVAGVLQCVFVLISGLIYW SHSE Sbjct: 77 LWLFLAYVVSFVSLAASVGLLIQDAMLPSGPSTWTGVAGVLQCVFVLISGLIYWTSHSE 135 >ref|XP_011027625.1| PREDICTED: transmembrane protein 50A-like [Populus euphratica] Length = 135 Score = 109 bits (273), Expect = 2e-27 Identities = 52/59 (88%), Positives = 55/59 (93%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLF AYVVSFVSLAASVGLLIQD++V+TGPS WTG AGVLQCVFVLISGLIYW SHSE Sbjct: 77 LWLFFAYVVSFVSLAASVGLLIQDSIVKTGPSVWTGTAGVLQCVFVLISGLIYWTSHSE 135 >ref|NP_001295740.1| transmembrane protein 50A [Jatropha curcas] gi|284521000|gb|ADB93075.1| transmembrane protein 50a, putative [Jatropha curcas] gi|643723135|gb|KDP32740.1| hypothetical protein JCGZ_12032 [Jatropha curcas] Length = 135 Score = 109 bits (273), Expect = 2e-27 Identities = 52/59 (88%), Positives = 55/59 (93%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLF AYVVSFVSLAASVGLLIQD++V+TGPS WTG AGVLQCVFVLISGLIYW SHSE Sbjct: 77 LWLFFAYVVSFVSLAASVGLLIQDSIVKTGPSVWTGTAGVLQCVFVLISGLIYWTSHSE 135 >ref|XP_002302262.1| hypothetical protein POPTR_0002s08980g [Populus trichocarpa] gi|222843988|gb|EEE81535.1| hypothetical protein POPTR_0002s08980g [Populus trichocarpa] Length = 135 Score = 109 bits (273), Expect = 2e-27 Identities = 52/59 (88%), Positives = 55/59 (93%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLF AYVVSFVSLAASVGLLIQD++V+TGPS WTG AGVLQCVFVLISGLIYW SHSE Sbjct: 77 LWLFFAYVVSFVSLAASVGLLIQDSIVKTGPSVWTGTAGVLQCVFVLISGLIYWTSHSE 135 >ref|XP_015571620.1| PREDICTED: transmembrane protein 50A [Ricinus communis] gi|1000977993|ref|XP_015571621.1| PREDICTED: transmembrane protein 50A [Ricinus communis] Length = 135 Score = 108 bits (271), Expect = 4e-27 Identities = 52/59 (88%), Positives = 55/59 (93%) Frame = -1 Query: 619 LWLFIAYVVSFVSLAASVGLLIQDALVETGPSAWTGVAGVLQCVFVLISGLIYWISHSE 443 LWLF AYVVSFVSLAASVGLLIQD+LV++GPS WTG AGVLQCVFVLISGLIYW SHSE Sbjct: 77 LWLFFAYVVSFVSLAASVGLLIQDSLVKSGPSVWTGTAGVLQCVFVLISGLIYWTSHSE 135