BLASTX nr result
ID: Rehmannia27_contig00019113
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00019113 (382 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097834.1| PREDICTED: grpE protein homolog, mitochondri... 80 2e-15 ref|XP_011097833.1| PREDICTED: grpE protein homolog, mitochondri... 80 3e-15 ref|XP_012841777.1| PREDICTED: grpE protein homolog, mitochondri... 70 9e-12 gb|EYU38920.1| hypothetical protein MIMGU_mgv1a017897mg [Erythra... 64 5e-11 ref|XP_002277588.2| PREDICTED: grpE protein homolog, mitochondri... 67 6e-11 ref|XP_010644499.1| PREDICTED: grpE protein homolog, mitochondri... 67 7e-11 emb|CAN76715.1| hypothetical protein VITISV_018795 [Vitis vinifera] 67 9e-11 ref|XP_012849279.1| PREDICTED: grpE protein homolog, mitochondri... 67 1e-10 gb|KNA10526.1| hypothetical protein SOVF_143620 [Spinacia oleracea] 65 3e-10 ref|XP_009402511.1| PREDICTED: grpE protein homolog, mitochondri... 65 6e-10 gb|KFK45111.1| hypothetical protein AALP_AA1G345900 [Arabis alpina] 60 8e-10 gb|EPS72920.1| hypothetical protein M569_01841 [Genlisea aurea] 64 8e-10 ref|XP_012070908.1| PREDICTED: grpE protein homolog, mitochondri... 64 9e-10 ref|XP_012070907.1| PREDICTED: grpE protein homolog, mitochondri... 64 1e-09 ref|XP_015582113.1| PREDICTED: protein GrpE isoform X4 [Ricinus ... 64 2e-09 ref|XP_002531197.1| PREDICTED: protein GrpE isoform X3 [Ricinus ... 64 2e-09 ref|XP_010675797.1| PREDICTED: grpE protein homolog, mitochondri... 64 2e-09 ref|XP_015582112.1| PREDICTED: protein GrpE isoform X2 [Ricinus ... 64 2e-09 ref|XP_015582111.1| PREDICTED: protein GrpE isoform X1 [Ricinus ... 64 2e-09 ref|XP_010675796.1| PREDICTED: grpE protein homolog, mitochondri... 64 2e-09 >ref|XP_011097834.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Sesamum indicum] Length = 324 Score = 79.7 bits (195), Expect = 2e-15 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE*GSK 244 PDASKPADRVAVVLKAGY+LHDR+IRPAEVGVTVAVN +EA GS+ Sbjct: 278 PDASKPADRVAVVLKAGYMLHDRVIRPAEVGVTVAVNKDEAGQGSE 323 >ref|XP_011097833.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Sesamum indicum] Length = 352 Score = 79.7 bits (195), Expect = 3e-15 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE*GSK 244 PDASKPADRVAVVLKAGY+LHDR+IRPAEVGVTVAVN +EA GS+ Sbjct: 306 PDASKPADRVAVVLKAGYMLHDRVIRPAEVGVTVAVNKDEAGQGSE 351 >ref|XP_012841777.1| PREDICTED: grpE protein homolog, mitochondrial-like [Erythranthe guttata] gi|604328005|gb|EYU33673.1| hypothetical protein MIMGU_mgv1a010831mg [Erythranthe guttata] Length = 300 Score = 69.7 bits (169), Expect = 9e-12 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 259 PDASKP V VVLKAGY+LHDR++RPAEVGVTVAV+NEE+ Sbjct: 260 PDASKPPGHVGVVLKAGYMLHDRVVRPAEVGVTVAVDNEES 300 >gb|EYU38920.1| hypothetical protein MIMGU_mgv1a017897mg [Erythranthe guttata] Length = 79 Score = 63.5 bits (153), Expect = 5e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVN 271 PDASKPA+ VAVVLK GY+LHDR+IR AEVGVTVA+N Sbjct: 39 PDASKPANHVAVVLKTGYMLHDRVIRRAEVGVTVAMN 75 >ref|XP_002277588.2| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Vitis vinifera] gi|297737494|emb|CBI26695.3| unnamed protein product [Vitis vinifera] Length = 298 Score = 67.4 bits (163), Expect = 6e-11 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE 256 PD SKP+ VAVVLKAGY+LHDR+IRPAEVGVT AV+N E E Sbjct: 256 PDPSKPSGTVAVVLKAGYMLHDRVIRPAEVGVTQAVDNNETE 297 >ref|XP_010644499.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Vitis vinifera] Length = 324 Score = 67.4 bits (163), Expect = 7e-11 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE 256 PD SKP+ VAVVLKAGY+LHDR+IRPAEVGVT AV+N E E Sbjct: 282 PDPSKPSGTVAVVLKAGYMLHDRVIRPAEVGVTQAVDNNETE 323 >emb|CAN76715.1| hypothetical protein VITISV_018795 [Vitis vinifera] Length = 413 Score = 67.4 bits (163), Expect = 9e-11 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE 256 PD SKP+ VAVVLKAGY+LHDR+IRPAEVGVT AV+N E E Sbjct: 371 PDPSKPSGTVAVVLKAGYMLHDRVIRPAEVGVTQAVDNNETE 412 >ref|XP_012849279.1| PREDICTED: grpE protein homolog, mitochondrial-like [Erythranthe guttata] gi|604314677|gb|EYU27383.1| hypothetical protein MIMGU_mgv1a011237mg [Erythranthe guttata] Length = 288 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVN 271 PDASKPA+ VAVVLKAGY+LHDR+IRPAEVGVTVA++ Sbjct: 252 PDASKPANHVAVVLKAGYMLHDRVIRPAEVGVTVAMS 288 >gb|KNA10526.1| hypothetical protein SOVF_143620 [Spinacia oleracea] Length = 300 Score = 65.5 bits (158), Expect = 3e-10 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE 256 PD SKP + VAVVLKAGY LHDRIIRPAEVGVT+A+ EA+ Sbjct: 258 PDNSKPPETVAVVLKAGYTLHDRIIRPAEVGVTIALEKNEAD 299 >ref|XP_009402511.1| PREDICTED: grpE protein homolog, mitochondrial [Musa acuminata subsp. malaccensis] Length = 299 Score = 64.7 bits (156), Expect = 6e-10 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE*GSKG 241 PDASKP VA VLK+GY LHDR+IRPAEVGVT ++ NE AE GS G Sbjct: 252 PDASKPPATVAAVLKSGYTLHDRVIRPAEVGVTQSLTNEPAE-GSNG 297 >gb|KFK45111.1| hypothetical protein AALP_AA1G345900 [Arabis alpina] Length = 51 Score = 59.7 bits (143), Expect = 8e-10 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE 256 PDASKP +A VLK GY L DR+IRPAEVGVT AV N+E E Sbjct: 5 PDASKPEGTIAHVLKPGYSLFDRVIRPAEVGVTCAVENQEGE 46 >gb|EPS72920.1| hypothetical protein M569_01841 [Genlisea aurea] Length = 296 Score = 64.3 bits (155), Expect = 8e-10 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNE 265 PD SKP RVAVVLKAGY+LHDR+IRPAEVGVT A E Sbjct: 258 PDPSKPEGRVAVVLKAGYVLHDRVIRPAEVGVTAAAGGE 296 >ref|XP_012070908.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Jatropha curcas] Length = 314 Score = 64.3 bits (155), Expect = 9e-10 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNE 265 PDASKP VA VLKAGY+L+DR+IRPAEVGVT+AV+N+ Sbjct: 266 PDASKPPGTVAAVLKAGYVLYDRVIRPAEVGVTIAVDND 304 >ref|XP_012070907.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Jatropha curcas] gi|643732002|gb|KDP39194.1| hypothetical protein JCGZ_00951 [Jatropha curcas] Length = 343 Score = 64.3 bits (155), Expect = 1e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNE 265 PDASKP VA VLKAGY+L+DR+IRPAEVGVT+AV+N+ Sbjct: 295 PDASKPPGTVAAVLKAGYVLYDRVIRPAEVGVTIAVDND 333 >ref|XP_015582113.1| PREDICTED: protein GrpE isoform X4 [Ricinus communis] Length = 303 Score = 63.5 bits (153), Expect = 2e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 259 PD+SKP VAVVLKAGY+LHDR+IRPAEVGVT V N+ A Sbjct: 260 PDSSKPPGTVAVVLKAGYLLHDRVIRPAEVGVTKEVENDTA 300 >ref|XP_002531197.1| PREDICTED: protein GrpE isoform X3 [Ricinus communis] gi|223529199|gb|EEF31174.1| Protein grpE, putative [Ricinus communis] Length = 308 Score = 63.5 bits (153), Expect = 2e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 259 PD+SKP VAVVLKAGY+LHDR+IRPAEVGVT V N+ A Sbjct: 265 PDSSKPPGTVAVVLKAGYLLHDRVIRPAEVGVTKEVENDTA 305 >ref|XP_010675797.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Beta vulgaris subsp. vulgaris] gi|870861545|gb|KMT12817.1| hypothetical protein BVRB_4g089100 [Beta vulgaris subsp. vulgaris] Length = 309 Score = 63.5 bits (153), Expect = 2e-09 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 259 PD SKP VAVVLKAGY LH+RIIRPAEVGVTVA N EA Sbjct: 268 PDNSKPPGTVAVVLKAGYTLHERIIRPAEVGVTVAPENNEA 308 >ref|XP_015582112.1| PREDICTED: protein GrpE isoform X2 [Ricinus communis] Length = 332 Score = 63.5 bits (153), Expect = 2e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 259 PD+SKP VAVVLKAGY+LHDR+IRPAEVGVT V N+ A Sbjct: 289 PDSSKPPGTVAVVLKAGYLLHDRVIRPAEVGVTKEVENDTA 329 >ref|XP_015582111.1| PREDICTED: protein GrpE isoform X1 [Ricinus communis] Length = 337 Score = 63.5 bits (153), Expect = 2e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 259 PD+SKP VAVVLKAGY+LHDR+IRPAEVGVT V N+ A Sbjct: 294 PDSSKPPGTVAVVLKAGYLLHDRVIRPAEVGVTKEVENDTA 334 >ref|XP_010675796.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Beta vulgaris subsp. vulgaris] Length = 337 Score = 63.5 bits (153), Expect = 2e-09 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = -2 Query: 381 PDASKPADRVAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 259 PD SKP VAVVLKAGY LH+RIIRPAEVGVTVA N EA Sbjct: 296 PDNSKPPGTVAVVLKAGYTLHERIIRPAEVGVTVAPENNEA 336