BLASTX nr result
ID: Rehmannia27_contig00018767
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00018767 (1927 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008808665.1| PREDICTED: zinc finger A20 and AN1 domain-co... 60 3e-07 ref|XP_010928202.1| PREDICTED: zinc finger A20 and AN1 domain-co... 60 4e-07 ref|XP_010925078.1| PREDICTED: zinc finger A20 and AN1 domain-co... 60 6e-07 ref|XP_012852257.1| PREDICTED: zinc finger A20 and AN1 domain-co... 58 3e-06 emb|CDJ89180.1| Zinc finger domain containing protein [Haemonchu... 59 3e-06 >ref|XP_008808665.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Phoenix dactylifera] gi|672112997|ref|XP_008808673.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Phoenix dactylifera] gi|672112999|ref|XP_008808683.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Phoenix dactylifera] Length = 164 Score = 60.5 bits (145), Expect = 3e-07 Identities = 31/68 (45%), Positives = 37/68 (54%) Frame = -2 Query: 1164 ESCKTNIRSRHQQTETPPASLCRGGCGFFGSEANRGLCSKCYNNFLLQKSSASVNPLDLI 985 ES K QT P +LC CGFFGS A LCSKCY ++ L KS ASV L + Sbjct: 4 ESQKREAEETEFQTPNMP-TLCANNCGFFGSPATNNLCSKCYKDYFLSKSKASVETLLVP 62 Query: 984 PPTNRKRL 961 PP K++ Sbjct: 63 PPVEAKKV 70 >ref|XP_010928202.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Elaeis guineensis] Length = 164 Score = 60.1 bits (144), Expect = 4e-07 Identities = 30/68 (44%), Positives = 37/68 (54%) Frame = -2 Query: 1164 ESCKTNIRSRHQQTETPPASLCRGGCGFFGSEANRGLCSKCYNNFLLQKSSASVNPLDLI 985 ES K QT P +LC CGFFGS A LCSKCY ++ L KS AS+ L + Sbjct: 4 ESQKREAEETEFQTPNIP-TLCANNCGFFGSPATNNLCSKCYKDYFLSKSKASIETLVVP 62 Query: 984 PPTNRKRL 961 PP K++ Sbjct: 63 PPAEAKKV 70 >ref|XP_010925078.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Elaeis guineensis] Length = 164 Score = 59.7 bits (143), Expect = 6e-07 Identities = 30/68 (44%), Positives = 37/68 (54%) Frame = -2 Query: 1164 ESCKTNIRSRHQQTETPPASLCRGGCGFFGSEANRGLCSKCYNNFLLQKSSASVNPLDLI 985 ES K QT P +LC CGFFGS A LCSKCY ++ L KS AS+ L + Sbjct: 4 ESQKREAEETEFQTPNIP-TLCANNCGFFGSPATNNLCSKCYKDYFLSKSKASIETLLVP 62 Query: 984 PPTNRKRL 961 PP K++ Sbjct: 63 PPVEAKKV 70 >ref|XP_012852257.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1-like [Erythranthe guttata] gi|604305953|gb|EYU25010.1| hypothetical protein MIMGU_mgv1a014891mg [Erythranthe guttata] Length = 174 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/58 (51%), Positives = 35/58 (60%) Frame = -2 Query: 1179 MDSSPESCKTNIRSRHQQTETPPASLCRGGCGFFGSEANRGLCSKCYNNFLLQKSSAS 1006 MDSS S N S H E P LC GCGFFG+ NRGLCSKCY++ L +K + S Sbjct: 1 MDSSSSSSTDNGGSHHHPHEQNP--LCAAGCGFFGTAENRGLCSKCYSDELKRKIAKS 56 >emb|CDJ89180.1| Zinc finger domain containing protein [Haemonchus contortus] Length = 211 Score = 58.5 bits (140), Expect = 3e-06 Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = -2 Query: 1170 SPESCKTNIRSRHQQTETPPASLCRGGCGFFGSEANRGLCSKCYNNFLLQ-KSSASVNPL 994 SP C T+ Q + SLCR GCGFFGS+AN GLCSKC+ + + + + +A ++P Sbjct: 16 SPVPCVTSQVDMENQQQPSTTSLCRNGCGFFGSQANEGLCSKCFKDSIKRNQDTARLSPT 75 Query: 993 DLIPPT 976 +P T Sbjct: 76 VPMPMT 81