BLASTX nr result
ID: Rehmannia27_contig00018765
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00018765 (522 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272066.1| PREDICTED: UBA and UBX domain-containing pro... 70 3e-11 emb|CBI33000.3| unnamed protein product [Vitis vinifera] 70 4e-11 ref|XP_011096004.1| PREDICTED: UBA and UBX domain-containing pro... 69 6e-11 ref|XP_007026187.1| Plant UBX domain containing protein 4 [Theob... 69 7e-11 ref|XP_006383856.1| hypothetical protein POPTR_0004s00620g [Popu... 68 7e-11 ref|XP_011096001.1| PREDICTED: UBA and UBX domain-containing pro... 69 9e-11 gb|KCW75234.1| hypothetical protein EUGRSUZ_E03986 [Eucalyptus g... 68 1e-10 ref|XP_010057888.1| PREDICTED: UBA and UBX domain-containing pro... 68 2e-10 gb|KCW75233.1| hypothetical protein EUGRSUZ_E03986 [Eucalyptus g... 68 2e-10 ref|XP_012444606.1| PREDICTED: plant UBX domain-containing prote... 67 5e-10 gb|KHG28913.1| hypothetical protein F383_12290 [Gossypium arboreum] 67 5e-10 ref|XP_011002563.1| PREDICTED: UBA and UBX domain-containing pro... 67 5e-10 ref|XP_002317152.1| phosphatase-like protein Psc923 [Populus tri... 67 5e-10 ref|XP_006389605.1| hypothetical protein POPTR_0021s00560g [Popu... 65 8e-10 ref|XP_015879610.1| PREDICTED: plant UBX domain-containing prote... 66 8e-10 ref|XP_012091288.1| PREDICTED: UBA and UBX domain-containing pro... 66 9e-10 ref|XP_006383854.1| hypothetical protein POPTR_0004s00590g [Popu... 66 9e-10 ref|XP_008798049.1| PREDICTED: UBA and UBX domain-containing pro... 65 1e-09 ref|XP_011046995.1| PREDICTED: UBA and UBX domain-containing pro... 65 1e-09 ref|XP_006383853.1| hypothetical protein POPTR_0004s00590g [Popu... 65 1e-09 >ref|XP_002272066.1| PREDICTED: UBA and UBX domain-containing protein At4g15410 isoform X1 [Vitis vinifera] gi|731435205|ref|XP_010645353.1| PREDICTED: UBA and UBX domain-containing protein At4g15410 isoform X2 [Vitis vinifera] gi|147798327|emb|CAN74529.1| hypothetical protein VITISV_031346 [Vitis vinifera] gi|297741768|emb|CBI32997.3| unnamed protein product [Vitis vinifera] Length = 299 Score = 70.1 bits (170), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEPADRRSSVHVNLIRRDENCP Sbjct: 142 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 173 >emb|CBI33000.3| unnamed protein product [Vitis vinifera] Length = 428 Score = 70.1 bits (170), Expect = 4e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEPADRRSSVHVNLIRRDENCP Sbjct: 142 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 173 >ref|XP_011096004.1| PREDICTED: UBA and UBX domain-containing protein At4g15410-like isoform X2 [Sesamum indicum] Length = 295 Score = 68.9 bits (167), Expect = 6e-11 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 132 PTSMSIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 P SIRKSECPKELEPADRRSSVHVNLIRR+ENCP Sbjct: 134 PFLESIRKSECPKELEPADRRSSVHVNLIRREENCP 169 >ref|XP_007026187.1| Plant UBX domain containing protein 4 [Theobroma cacao] gi|508781553|gb|EOY28809.1| Plant UBX domain containing protein 4 [Theobroma cacao] Length = 306 Score = 68.9 bits (167), Expect = 7e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEPADRRS+VHVNLIRRDENCP Sbjct: 147 SIRKSECPKELEPADRRSAVHVNLIRRDENCP 178 >ref|XP_006383856.1| hypothetical protein POPTR_0004s00620g [Populus trichocarpa] gi|550340002|gb|ERP61653.1| hypothetical protein POPTR_0004s00620g [Populus trichocarpa] Length = 218 Score = 67.8 bits (164), Expect = 7e-11 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCPLV 19 SIRKSECPKELEPADRRSSVHVNL RRD+NCP++ Sbjct: 110 SIRKSECPKELEPADRRSSVHVNLTRRDQNCPVM 143 >ref|XP_011096001.1| PREDICTED: UBA and UBX domain-containing protein At4g15410-like isoform X1 [Sesamum indicum] gi|747096187|ref|XP_011096002.1| PREDICTED: UBA and UBX domain-containing protein At4g15410-like isoform X1 [Sesamum indicum] gi|747096189|ref|XP_011096003.1| PREDICTED: UBA and UBX domain-containing protein At4g15410-like isoform X1 [Sesamum indicum] Length = 349 Score = 68.9 bits (167), Expect = 9e-11 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 132 PTSMSIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 P SIRKSECPKELEPADRRSSVHVNLIRR+ENCP Sbjct: 134 PFLESIRKSECPKELEPADRRSSVHVNLIRREENCP 169 >gb|KCW75234.1| hypothetical protein EUGRSUZ_E03986 [Eucalyptus grandis] Length = 252 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEPADRRSSVHVNLIRRDE CP Sbjct: 95 SIRKSECPKELEPADRRSSVHVNLIRRDEKCP 126 >ref|XP_010057888.1| PREDICTED: UBA and UBX domain-containing protein At4g15410 [Eucalyptus grandis] gi|702351658|ref|XP_010057889.1| PREDICTED: UBA and UBX domain-containing protein At4g15410 [Eucalyptus grandis] Length = 303 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEPADRRSSVHVNLIRRDE CP Sbjct: 146 SIRKSECPKELEPADRRSSVHVNLIRRDEKCP 177 >gb|KCW75233.1| hypothetical protein EUGRSUZ_E03986 [Eucalyptus grandis] Length = 341 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEPADRRSSVHVNLIRRDE CP Sbjct: 184 SIRKSECPKELEPADRRSSVHVNLIRRDEKCP 215 >ref|XP_012444606.1| PREDICTED: plant UBX domain-containing protein 4-like [Gossypium raimondii] gi|763790814|gb|KJB57810.1| hypothetical protein B456_009G181600 [Gossypium raimondii] Length = 303 Score = 66.6 bits (161), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEPADRRSSVHVNLI+RDE CP Sbjct: 145 SIRKSECPKELEPADRRSSVHVNLIKRDEKCP 176 >gb|KHG28913.1| hypothetical protein F383_12290 [Gossypium arboreum] Length = 303 Score = 66.6 bits (161), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEPADRRSSVHVNLI+RDE CP Sbjct: 145 SIRKSECPKELEPADRRSSVHVNLIKRDEKCP 176 >ref|XP_011002563.1| PREDICTED: UBA and UBX domain-containing protein At4g15410-like [Populus euphratica] Length = 305 Score = 66.6 bits (161), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEPADRRSSVHVNLIRRD+ CP Sbjct: 147 SIRKSECPKELEPADRRSSVHVNLIRRDQKCP 178 >ref|XP_002317152.1| phosphatase-like protein Psc923 [Populus trichocarpa] gi|222860217|gb|EEE97764.1| phosphatase-like protein Psc923 [Populus trichocarpa] Length = 305 Score = 66.6 bits (161), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEPADRRSSVHVNLIRRD+ CP Sbjct: 147 SIRKSECPKELEPADRRSSVHVNLIRRDQKCP 178 >ref|XP_006389605.1| hypothetical protein POPTR_0021s00560g [Populus trichocarpa] gi|550312434|gb|ERP48519.1| hypothetical protein POPTR_0021s00560g [Populus trichocarpa] Length = 253 Score = 65.5 bits (158), Expect = 8e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEPADRRSSVHVNLIR+D+ CP Sbjct: 95 SIRKSECPKELEPADRRSSVHVNLIRKDQKCP 126 >ref|XP_015879610.1| PREDICTED: plant UBX domain-containing protein 4-like isoform X1 [Ziziphus jujuba] Length = 293 Score = 65.9 bits (159), Expect = 8e-10 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SI+KSECPKELEPADRR+SVHVNLIRR+ENCP Sbjct: 142 SIKKSECPKELEPADRRTSVHVNLIRRNENCP 173 >ref|XP_012091288.1| PREDICTED: UBA and UBX domain-containing protein At4g15410-like [Jatropha curcas] gi|643703634|gb|KDP20698.1| hypothetical protein JCGZ_21169 [Jatropha curcas] Length = 303 Score = 65.9 bits (159), Expect = 9e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEP DRRSSVHVNLIRRDE CP Sbjct: 146 SIRKSECPKELEPEDRRSSVHVNLIRRDEQCP 177 >ref|XP_006383854.1| hypothetical protein POPTR_0004s00590g [Populus trichocarpa] gi|550340000|gb|ERP61651.1| hypothetical protein POPTR_0004s00590g [Populus trichocarpa] Length = 309 Score = 65.9 bits (159), Expect = 9e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCPL 22 SIRKSECPKELEP+DRRSSVHVNLIRRD+ CP+ Sbjct: 152 SIRKSECPKELEPSDRRSSVHVNLIRRDQKCPV 184 >ref|XP_008798049.1| PREDICTED: UBA and UBX domain-containing protein At4g15410 [Phoenix dactylifera] Length = 304 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEPADRRS+VHVNLIRR+E+CP Sbjct: 145 SIRKSECPKELEPADRRSTVHVNLIRREESCP 176 >ref|XP_011046995.1| PREDICTED: UBA and UBX domain-containing protein At4g15410-like [Populus euphratica] Length = 305 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEP+DRRSSVHVNLIRRD+ CP Sbjct: 147 SIRKSECPKELEPSDRRSSVHVNLIRRDQKCP 178 >ref|XP_006383853.1| hypothetical protein POPTR_0004s00590g [Populus trichocarpa] gi|118488401|gb|ABK96017.1| unknown [Populus trichocarpa] gi|550339999|gb|ERP61650.1| hypothetical protein POPTR_0004s00590g [Populus trichocarpa] Length = 305 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 120 SIRKSECPKELEPADRRSSVHVNLIRRDENCP 25 SIRKSECPKELEP+DRRSSVHVNLIRRD+ CP Sbjct: 147 SIRKSECPKELEPSDRRSSVHVNLIRRDQKCP 178