BLASTX nr result
ID: Rehmannia27_contig00017487
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00017487 (365 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31860.1| hypothetical protein MIMGU_mgv1a023983mg, partial... 60 2e-08 ref|XP_012844046.1| PREDICTED: acyltransferase-like protein At3g... 60 2e-08 ref|XP_011045777.1| PREDICTED: acyltransferase-like protein At3g... 53 8e-06 ref|XP_002300135.2| hypothetical protein POPTR_0001s33160g [Popu... 53 8e-06 >gb|EYU31860.1| hypothetical protein MIMGU_mgv1a023983mg, partial [Erythranthe guttata] Length = 624 Score = 60.5 bits (145), Expect = 2e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 365 SDPYRNIFTRLSYQATHGFDSEVPTFDFNKAP 270 +DPYRN+F RL+Y+ATHGFD+EVPTFDF K+P Sbjct: 593 NDPYRNMFARLTYKATHGFDAEVPTFDFTKSP 624 >ref|XP_012844046.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic [Erythranthe guttata] Length = 722 Score = 60.5 bits (145), Expect = 2e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 365 SDPYRNIFTRLSYQATHGFDSEVPTFDFNKAP 270 +DPYRN+F RL+Y+ATHGFD+EVPTFDF K+P Sbjct: 691 NDPYRNMFARLTYKATHGFDAEVPTFDFTKSP 722 >ref|XP_011045777.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic [Populus euphratica] Length = 661 Score = 53.1 bits (126), Expect = 8e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -1 Query: 365 SDPYRNIFTRLSYQATHGFDSEVPTFD 285 SDPYRNI RL+YQA+HGFD+EVPTFD Sbjct: 634 SDPYRNILARLAYQASHGFDAEVPTFD 660 >ref|XP_002300135.2| hypothetical protein POPTR_0001s33160g [Populus trichocarpa] gi|550348757|gb|EEE84940.2| hypothetical protein POPTR_0001s33160g [Populus trichocarpa] Length = 723 Score = 53.1 bits (126), Expect = 8e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -1 Query: 365 SDPYRNIFTRLSYQATHGFDSEVPTFD 285 SDPYRNI RL+YQA+HGFD+EVPTFD Sbjct: 696 SDPYRNILARLAYQASHGFDAEVPTFD 722