BLASTX nr result
ID: Rehmannia27_contig00017120
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00017120 (1188 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64951.1| hypothetical protein M569_09827, partial [Genlise... 58 7e-06 gb|EYU27092.1| hypothetical protein MIMGU_mgv1a0066542mg, partia... 58 8e-06 ref|XP_012849764.1| PREDICTED: chaperone protein dnaJ 1, mitocho... 58 9e-06 >gb|EPS64951.1| hypothetical protein M569_09827, partial [Genlisea aurea] Length = 366 Score = 58.2 bits (139), Expect = 7e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 MIKVREDPVFRREGADIHVDAVLSITQVIL 91 MIKVREDPVFRREG+DIHVDAVLSITQ IL Sbjct: 265 MIKVREDPVFRREGSDIHVDAVLSITQAIL 294 >gb|EYU27092.1| hypothetical protein MIMGU_mgv1a0066542mg, partial [Erythranthe guttata] Length = 382 Score = 58.2 bits (139), Expect = 8e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 MIKVREDPVFRREGADIHVDAVLSITQVIL 91 +IKVREDPVFRREGADIHVDAVLSITQ IL Sbjct: 321 LIKVREDPVFRREGADIHVDAVLSITQAIL 350 >ref|XP_012849764.1| PREDICTED: chaperone protein dnaJ 1, mitochondrial [Erythranthe guttata] Length = 436 Score = 58.2 bits (139), Expect = 9e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 MIKVREDPVFRREGADIHVDAVLSITQVIL 91 +IKVREDPVFRREGADIHVDAVLSITQ IL Sbjct: 321 LIKVREDPVFRREGADIHVDAVLSITQAIL 350