BLASTX nr result
ID: Rehmannia27_contig00016457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00016457 (581 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_398865.1| hypothetical protein NitoCp030 [Nicotiana tomen... 56 3e-10 ref|NP_054501.1| hypothetical protein NitaCp025 [Nicotiana tabac... 57 9e-08 >ref|YP_398865.1| hypothetical protein NitoCp030 [Nicotiana tomentosiformis] gi|80750927|dbj|BAE48003.1| hypothetical protein [Nicotiana tomentosiformis] Length = 70 Score = 55.8 bits (133), Expect(2) = 3e-10 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 245 KMVGKETYIWGIYQSILNCRYRNNKIQFDWSK 340 KM G+ETY WGIY SILNC +RN+KI FDW+K Sbjct: 35 KMAGRETYGWGIYPSILNCGFRNDKIIFDWTK 66 Score = 35.8 bits (81), Expect(2) = 3e-10 Identities = 20/32 (62%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = +1 Query: 160 LVITNQTFLVFHS*---KGKNRPFKYPKL*GK 246 LVITN+TFL F + K KNRPFKY K GK Sbjct: 4 LVITNETFLRFQAKVKIKKKNRPFKYSKFNGK 35 >ref|NP_054501.1| hypothetical protein NitaCp025 [Nicotiana tabacum] gi|78102537|ref|YP_358678.1| hypothetical protein NisyCp031 [Nicotiana sylvestris] gi|11835|emb|CAA77355.1| hypothetical protein [Nicotiana tabacum] gi|77799564|dbj|BAE46653.1| hypothetical protein [Nicotiana sylvestris] gi|1001824196|gb|AMM05548.1| hypothetical protein (plastid) [Nicotiana tabacum] gi|225203|prf||1211235AH ORF 70A Length = 70 Score = 56.6 bits (135), Expect = 9e-08 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = +2 Query: 194 IRKKGKIDRSSIPNCREKMVGKETYIWGIYQSILNCRYRNNKIQFDWSK 340 I+KK + + S N KM G+ETY WGIY SILNC +RN+KI FDW+K Sbjct: 20 IKKKNRPFKYSKLN--GKMAGRETYRWGIYPSILNCGFRNDKIIFDWTK 66