BLASTX nr result
ID: Rehmannia27_contig00016174
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00016174 (387 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010092438.1| CCR4-NOT transcription complex subunit 3 [Mo... 91 7e-20 dbj|BAH56762.1| AT5G18230 [Arabidopsis thaliana] 90 1e-19 ref|XP_011464447.1| PREDICTED: CCR4-NOT transcription complex su... 92 3e-19 ref|XP_011464446.1| PREDICTED: general negative regulator of tra... 92 3e-19 ref|XP_010523111.1| PREDICTED: CCR4-NOT transcription complex su... 91 4e-19 gb|KJB80952.1| hypothetical protein B456_013G123000 [Gossypium r... 91 4e-19 gb|KOM55880.1| hypothetical protein LR48_Vigan10g177200 [Vigna a... 91 4e-19 ref|XP_006443382.1| hypothetical protein CICLE_v10018788mg [Citr... 91 4e-19 ref|XP_015902342.1| PREDICTED: CCR4-NOT transcription complex su... 91 4e-19 ref|XP_006443384.1| hypothetical protein CICLE_v10018788mg [Citr... 91 5e-19 gb|KJB80953.1| hypothetical protein B456_013G123000 [Gossypium r... 91 5e-19 emb|CAN83574.1| hypothetical protein VITISV_041711 [Vitis vinifera] 91 5e-19 ref|XP_006443385.1| hypothetical protein CICLE_v10018788mg [Citr... 91 5e-19 gb|KDO55085.1| hypothetical protein CISIN_1g0026781mg, partial [... 91 5e-19 ref|XP_006443387.1| hypothetical protein CICLE_v10018788mg [Citr... 91 5e-19 gb|KDO55086.1| hypothetical protein CISIN_1g0026781mg, partial [... 91 5e-19 gb|KDO55087.1| hypothetical protein CISIN_1g0026781mg, partial [... 91 5e-19 gb|KJB80954.1| hypothetical protein B456_013G123000 [Gossypium r... 91 5e-19 gb|KJB45058.1| hypothetical protein B456_007G287600 [Gossypium r... 91 5e-19 gb|KVH90623.1| CCR4-NOT complex, subunit 3/ 5 [Cynara cardunculu... 91 5e-19 >ref|XP_010092438.1| CCR4-NOT transcription complex subunit 3 [Morus notabilis] gi|587861350|gb|EXB51204.1| CCR4-NOT transcription complex subunit 3 [Morus notabilis] Length = 278 Score = 91.3 bits (225), Expect = 7e-20 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 78 >dbj|BAH56762.1| AT5G18230 [Arabidopsis thaliana] Length = 228 Score = 89.7 bits (221), Expect = 1e-19 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDN NQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 35 YDTDNVNQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 80 >ref|XP_011464447.1| PREDICTED: CCR4-NOT transcription complex subunit 3 isoform X2 [Fragaria vesca subsp. vesca] Length = 882 Score = 92.0 bits (227), Expect = 3e-19 Identities = 45/50 (90%), Positives = 45/50 (90%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGARVHS 131 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A S Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSASYES 82 >ref|XP_011464446.1| PREDICTED: general negative regulator of transcription subunit 3 isoform X1 [Fragaria vesca subsp. vesca] Length = 901 Score = 92.0 bits (227), Expect = 3e-19 Identities = 45/50 (90%), Positives = 45/50 (90%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGARVHS 131 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A S Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSASYES 82 >ref|XP_010523111.1| PREDICTED: CCR4-NOT transcription complex subunit 3-like, partial [Tarenaya hassleriana] Length = 502 Score = 91.3 bits (225), Expect = 4e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 78 >gb|KJB80952.1| hypothetical protein B456_013G123000 [Gossypium raimondii] Length = 506 Score = 91.3 bits (225), Expect = 4e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKISA 78 >gb|KOM55880.1| hypothetical protein LR48_Vigan10g177200 [Vigna angularis] Length = 514 Score = 91.3 bits (225), Expect = 4e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 78 >ref|XP_006443382.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|557545644|gb|ESR56622.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 557 Score = 91.3 bits (225), Expect = 4e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 78 >ref|XP_015902342.1| PREDICTED: CCR4-NOT transcription complex subunit 3 [Ziziphus jujuba] Length = 566 Score = 91.3 bits (225), Expect = 4e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 78 >ref|XP_006443384.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|557545646|gb|ESR56624.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|641836123|gb|KDO55092.1| hypothetical protein CISIN_1g0026781mg [Citrus sinensis] Length = 576 Score = 91.3 bits (225), Expect = 5e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 78 >gb|KJB80953.1| hypothetical protein B456_013G123000 [Gossypium raimondii] Length = 623 Score = 91.3 bits (225), Expect = 5e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKISA 78 >emb|CAN83574.1| hypothetical protein VITISV_041711 [Vitis vinifera] Length = 652 Score = 91.3 bits (225), Expect = 5e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 78 >ref|XP_006443385.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|557545647|gb|ESR56625.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 652 Score = 91.3 bits (225), Expect = 5e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 78 >gb|KDO55085.1| hypothetical protein CISIN_1g0026781mg, partial [Citrus sinensis] Length = 653 Score = 91.3 bits (225), Expect = 5e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 78 >ref|XP_006443387.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|557545649|gb|ESR56627.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 671 Score = 91.3 bits (225), Expect = 5e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 78 >gb|KDO55086.1| hypothetical protein CISIN_1g0026781mg, partial [Citrus sinensis] Length = 672 Score = 91.3 bits (225), Expect = 5e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 78 >gb|KDO55087.1| hypothetical protein CISIN_1g0026781mg, partial [Citrus sinensis] Length = 673 Score = 91.3 bits (225), Expect = 5e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 78 >gb|KJB80954.1| hypothetical protein B456_013G123000 [Gossypium raimondii] Length = 761 Score = 91.3 bits (225), Expect = 5e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKISA 78 >gb|KJB45058.1| hypothetical protein B456_007G287600 [Gossypium raimondii] Length = 762 Score = 91.3 bits (225), Expect = 5e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 78 >gb|KVH90623.1| CCR4-NOT complex, subunit 3/ 5 [Cynara cardunculus var. scolymus] Length = 788 Score = 91.3 bits (225), Expect = 5e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -3 Query: 280 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKSGA 143 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKK A Sbjct: 33 YDTDNANQKEKFEADLKKEIKKLQRYRDQIKTWIQSSEIKDKKVSA 78