BLASTX nr result
ID: Rehmannia27_contig00015463
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00015463 (405 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087967.1| PREDICTED: S phase cyclin A-associated prote... 58 2e-07 >ref|XP_011087967.1| PREDICTED: S phase cyclin A-associated protein in the endoplasmic reticulum-like [Sesamum indicum] Length = 415 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +1 Query: 16 QQKTVRPNQSGGDTDQQFKAFCNVCNVKMPSEIDLISHLKGKRHLSIIQ 162 QQ +P Q+G +QQF A+C VC+VK+ SEIDL SHL+GKRH S +Q Sbjct: 366 QQNQGKPKQNGA-ANQQFHAWCTVCHVKLLSEIDLASHLRGKRHTSNVQ 413