BLASTX nr result
ID: Rehmannia27_contig00015322
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00015322 (424 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098529.1| PREDICTED: chloroplastic group IIA intron sp... 63 7e-09 >ref|XP_011098529.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic [Sesamum indicum] Length = 1054 Score = 62.8 bits (151), Expect = 7e-09 Identities = 32/44 (72%), Positives = 34/44 (77%) Frame = +1 Query: 4 EPDQTSGKVNKNLKYQLVGGEVKPRLLISPELISAMRLECGLKS 135 EPDQ SGKVNK+LK GE K R ISPELISA+RLECGLKS Sbjct: 1010 EPDQASGKVNKDLKNDSARGEAKARQHISPELISAIRLECGLKS 1053