BLASTX nr result
ID: Rehmannia27_contig00015044
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00015044 (360 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012842676.1| PREDICTED: pentatricopeptide repeat-containi... 66 2e-10 ref|XP_011097861.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-08 >ref|XP_012842676.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Erythranthe guttata] gi|604327040|gb|EYU32989.1| hypothetical protein MIMGU_mgv1a018420mg [Erythranthe guttata] Length = 488 Score = 66.2 bits (160), Expect = 2e-10 Identities = 37/74 (50%), Positives = 44/74 (59%) Frame = -1 Query: 222 MNLTNKTSKLTNFKIXXXXXXXXXXXXXXXXXXXXPATIANLILKADNPESLTQTLHSLP 43 MN ++K KLT FK TI NLILKA+N +SLTQTLHS+ Sbjct: 1 MNQSSKPFKLTIFKTPQKPPSTTTTTFSRQPPLDL-TTITNLILKAENQDSLTQTLHSIS 59 Query: 42 EWTPHLVQTVLKRL 1 EWTPHLVQT+LKR+ Sbjct: 60 EWTPHLVQTILKRI 73 >ref|XP_011097861.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Sesamum indicum] Length = 479 Score = 61.2 bits (147), Expect = 1e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 114 ATIANLILKADNPESLTQTLHSLPEWTPHLVQTVLKRL 1 A I N ILK+DNP+SLTQTLH+L WTP+LVQT+LKRL Sbjct: 29 AAITNQILKSDNPQSLTQTLHTLSGWTPNLVQTILKRL 66