BLASTX nr result
ID: Rehmannia27_contig00014780
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00014780 (635 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63809.1| hypothetical protein M569_10976 [Genlisea aurea] 54 6e-07 >gb|EPS63809.1| hypothetical protein M569_10976 [Genlisea aurea] Length = 54 Score = 54.3 bits (129), Expect = 6e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 338 LFGFFVVEAYPKRYSSKIPSDLVLFLGLGFID 243 L G ++EAY KRYSSKIPSDLVLFLGLGFID Sbjct: 20 LSGLLLLEAYNKRYSSKIPSDLVLFLGLGFID 51