BLASTX nr result
ID: Rehmannia27_contig00014488
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00014488 (374 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086710.1| PREDICTED: uncharacterized protein LOC105168... 57 2e-07 >ref|XP_011086710.1| PREDICTED: uncharacterized protein LOC105168352 [Sesamum indicum] Length = 318 Score = 57.4 bits (137), Expect = 2e-07 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -3 Query: 144 MDLLRTKYCFRINSCNLHLQAASQFLGRDGHICGNSNSPKFSTKLCFG 1 MDLL T C R+ S + + +AASQFLG D ICG S+SP F TKLC G Sbjct: 1 MDLLSTNCCLRVKSRSPYFRAASQFLGVDREICGCSSSPNFFTKLCCG 48