BLASTX nr result
ID: Rehmannia27_contig00014436
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00014436 (596 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088662.1| PREDICTED: rop guanine nucleotide exchange f... 109 2e-24 ref|XP_012837225.1| PREDICTED: rop guanine nucleotide exchange f... 105 6e-23 gb|EPS71259.1| hypothetical protein M569_03494 [Genlisea aurea] 92 2e-18 ref|XP_009347853.1| PREDICTED: rop guanine nucleotide exchange f... 89 4e-17 ref|XP_008365720.1| PREDICTED: rop guanine nucleotide exchange f... 89 4e-17 ref|XP_009347846.1| PREDICTED: rop guanine nucleotide exchange f... 89 4e-17 ref|XP_008365719.1| PREDICTED: rop guanine nucleotide exchange f... 89 4e-17 ref|XP_007199773.1| hypothetical protein PRUPE_ppa003680mg [Prun... 88 5e-17 ref|XP_008236096.1| PREDICTED: rop guanine nucleotide exchange f... 88 5e-17 ref|XP_010266943.1| PREDICTED: rop guanine nucleotide exchange f... 88 5e-17 ref|XP_008382457.1| PREDICTED: rop guanine nucleotide exchange f... 88 7e-17 gb|KDO68246.1| hypothetical protein CISIN_1g008192mg [Citrus sin... 87 7e-17 gb|KDO68247.1| hypothetical protein CISIN_1g008192mg [Citrus sin... 87 7e-17 ref|XP_006422485.1| hypothetical protein CICLE_v10028096mg [Citr... 87 7e-17 ref|XP_006486652.1| PREDICTED: rop guanine nucleotide exchange f... 87 9e-17 ref|XP_006422484.1| hypothetical protein CICLE_v10028096mg [Citr... 87 9e-17 ref|XP_008448331.1| PREDICTED: rop guanine nucleotide exchange f... 87 2e-16 ref|XP_010266083.1| PREDICTED: rop guanine nucleotide exchange f... 87 2e-16 ref|XP_015952711.1| PREDICTED: rop guanine nucleotide exchange f... 87 2e-16 ref|XP_004290034.1| PREDICTED: rop guanine nucleotide exchange f... 86 3e-16 >ref|XP_011088662.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Sesamum indicum] gi|747082659|ref|XP_011088663.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Sesamum indicum] Length = 565 Score = 109 bits (272), Expect = 2e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -1 Query: 161 LTPTFSFPLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 LTPTFSFP+IGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK Sbjct: 58 LTPTFSFPVIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 110 >ref|XP_012837225.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Erythranthe guttata] gi|848873334|ref|XP_012837226.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Erythranthe guttata] gi|604333649|gb|EYU38000.1| hypothetical protein MIMGU_mgv1a003780mg [Erythranthe guttata] Length = 564 Score = 105 bits (261), Expect = 6e-23 Identities = 50/53 (94%), Positives = 51/53 (96%) Frame = -1 Query: 161 LTPTFSFPLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 LTPTFSFPLIGGKDVVVWDEKP KR SDLSEI+MMKERFAKLLLGEDMSGGGK Sbjct: 58 LTPTFSFPLIGGKDVVVWDEKPHKRSSDLSEIDMMKERFAKLLLGEDMSGGGK 110 >gb|EPS71259.1| hypothetical protein M569_03494 [Genlisea aurea] Length = 557 Score = 92.0 bits (227), Expect = 2e-18 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = -1 Query: 161 LTPTFSFPLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 ++ F+FPL+GGKDVV W+EKP KRGS+LSEIEMMKERFAKLLLGEDMSG GK Sbjct: 53 VSTNFTFPLVGGKDVVAWNEKPHKRGSELSEIEMMKERFAKLLLGEDMSGSGK 105 >ref|XP_009347853.1| PREDICTED: rop guanine nucleotide exchange factor 1 isoform X2 [Pyrus x bretschneideri] Length = 562 Score = 88.6 bits (218), Expect = 4e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 140 PLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P+IGGKDVV WDEKP+KR +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 69 PVIGGKDVVAWDEKPEKRNADLSEVEMMKERFAKLLLGEDMSGGGK 114 >ref|XP_008365720.1| PREDICTED: rop guanine nucleotide exchange factor 1-like isoform X2 [Malus domestica] Length = 562 Score = 88.6 bits (218), Expect = 4e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 140 PLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P+IGGKDVV WDEKP+KR +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 69 PVIGGKDVVAWDEKPEKRNADLSEVEMMKERFAKLLLGEDMSGGGK 114 >ref|XP_009347846.1| PREDICTED: rop guanine nucleotide exchange factor 1 isoform X1 [Pyrus x bretschneideri] Length = 563 Score = 88.6 bits (218), Expect = 4e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 140 PLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P+IGGKDVV WDEKP+KR +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 69 PVIGGKDVVAWDEKPEKRNADLSEVEMMKERFAKLLLGEDMSGGGK 114 >ref|XP_008365719.1| PREDICTED: rop guanine nucleotide exchange factor 1-like isoform X1 [Malus domestica] Length = 563 Score = 88.6 bits (218), Expect = 4e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 140 PLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P+IGGKDVV WDEKP+KR +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 69 PVIGGKDVVAWDEKPEKRNADLSEVEMMKERFAKLLLGEDMSGGGK 114 >ref|XP_007199773.1| hypothetical protein PRUPE_ppa003680mg [Prunus persica] gi|462395173|gb|EMJ00972.1| hypothetical protein PRUPE_ppa003680mg [Prunus persica] Length = 557 Score = 88.2 bits (217), Expect = 5e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 140 PLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P+IGGKDVV WDEKP+KR +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 70 PVIGGKDVVAWDEKPEKRDADLSEVEMMKERFAKLLLGEDMSGGGK 115 >ref|XP_008236096.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Prunus mume] Length = 569 Score = 88.2 bits (217), Expect = 5e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 140 PLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P+IGGKDVV WDEKP+KR +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 70 PVIGGKDVVAWDEKPEKRDADLSEVEMMKERFAKLLLGEDMSGGGK 115 >ref|XP_010266943.1| PREDICTED: rop guanine nucleotide exchange factor 1-like [Nelumbo nucifera] Length = 579 Score = 88.2 bits (217), Expect = 5e-17 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = -1 Query: 155 PTFSFPLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P P+IGG+DVVVW+EKP+KR +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 69 PHLMLPVIGGRDVVVWEEKPEKREADLSEVEMMKERFAKLLLGEDMSGGGK 119 >ref|XP_008382457.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Malus domestica] Length = 563 Score = 87.8 bits (216), Expect = 7e-17 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = -1 Query: 155 PTFSFPLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P P+IGGKDVV WDE P+KR +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 64 PPVMLPVIGGKDVVAWDENPEKRDADLSEVEMMKERFAKLLLGEDMSGGGK 114 >gb|KDO68246.1| hypothetical protein CISIN_1g008192mg [Citrus sinensis] Length = 441 Score = 87.4 bits (215), Expect = 7e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 140 PLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P+IGGKDVVVWDEKP+K +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 72 PVIGGKDVVVWDEKPEKSDTDLSEVEMMKERFAKLLLGEDMSGGGK 117 >gb|KDO68247.1| hypothetical protein CISIN_1g008192mg [Citrus sinensis] Length = 448 Score = 87.4 bits (215), Expect = 7e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 140 PLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P+IGGKDVVVWDEKP+K +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 72 PVIGGKDVVVWDEKPEKSDTDLSEVEMMKERFAKLLLGEDMSGGGK 117 >ref|XP_006422485.1| hypothetical protein CICLE_v10028096mg [Citrus clementina] gi|557524419|gb|ESR35725.1| hypothetical protein CICLE_v10028096mg [Citrus clementina] Length = 448 Score = 87.4 bits (215), Expect = 7e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 140 PLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P+IGGKDVVVWDEKP+K +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 72 PVIGGKDVVVWDEKPEKSDTDLSEVEMMKERFAKLLLGEDMSGGGK 117 >ref|XP_006486652.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Citrus sinensis] gi|641849370|gb|KDO68245.1| hypothetical protein CISIN_1g008192mg [Citrus sinensis] Length = 574 Score = 87.4 bits (215), Expect = 9e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 140 PLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P+IGGKDVVVWDEKP+K +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 72 PVIGGKDVVVWDEKPEKSDTDLSEVEMMKERFAKLLLGEDMSGGGK 117 >ref|XP_006422484.1| hypothetical protein CICLE_v10028096mg [Citrus clementina] gi|557524418|gb|ESR35724.1| hypothetical protein CICLE_v10028096mg [Citrus clementina] Length = 574 Score = 87.4 bits (215), Expect = 9e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 140 PLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P+IGGKDVVVWDEKP+K +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 72 PVIGGKDVVVWDEKPEKSDTDLSEVEMMKERFAKLLLGEDMSGGGK 117 >ref|XP_008448331.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Cucumis melo] Length = 570 Score = 86.7 bits (213), Expect = 2e-16 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -1 Query: 155 PTFSFPLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P S PL+GGKDV VWD+K +KR +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 64 PPVSLPLLGGKDVFVWDDKSKKREADLSEVEMMKERFAKLLLGEDMSGGGK 114 >ref|XP_010266083.1| PREDICTED: rop guanine nucleotide exchange factor 1-like [Nelumbo nucifera] Length = 577 Score = 86.7 bits (213), Expect = 2e-16 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = -1 Query: 155 PTFSFPLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P P+IGG+DVV W+EKP+KR +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 69 PPLMLPVIGGRDVVFWEEKPEKREADLSEVEMMKERFAKLLLGEDMSGGGK 119 >ref|XP_015952711.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Arachis duranensis] Length = 583 Score = 86.7 bits (213), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 140 PLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P+IGGKDVVVWD KP+KR DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 77 PVIGGKDVVVWDHKPEKRDLDLSEVEMMKERFAKLLLGEDMSGGGK 122 >ref|XP_004290034.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Fragaria vesca subsp. vesca] Length = 569 Score = 85.9 bits (211), Expect = 3e-16 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = -1 Query: 140 PLIGGKDVVVWDEKPQKRGSDLSEIEMMKERFAKLLLGEDMSGGGK 3 P+IGGKDVV WD+KP+K+ +DLSE+EMMKERFAKLLLGEDMSGGGK Sbjct: 70 PVIGGKDVVAWDDKPEKKDADLSEVEMMKERFAKLLLGEDMSGGGK 115