BLASTX nr result
ID: Rehmannia27_contig00014351
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00014351 (519 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080872.1| PREDICTED: arabinogalactan peptide 22-like [... 60 2e-09 ref|XP_011073599.1| PREDICTED: arabinogalactan peptide 22-like [... 58 2e-08 gb|EYU40039.1| hypothetical protein MIMGU_mgv1a020427mg [Erythra... 57 8e-08 >ref|XP_011080872.1| PREDICTED: arabinogalactan peptide 22-like [Sesamum indicum] Length = 75 Score = 60.5 bits (145), Expect = 2e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 519 GTAIDQGIAYGLMLLALALTYFIHTFDAPLSI 424 GTAIDQGIAYGLMLLAL LTY IH+FDAPLS+ Sbjct: 44 GTAIDQGIAYGLMLLALVLTYLIHSFDAPLSV 75 >ref|XP_011073599.1| PREDICTED: arabinogalactan peptide 22-like [Sesamum indicum] Length = 75 Score = 57.8 bits (138), Expect = 2e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 519 GTAIDQGIAYGLMLLALALTYFIHTFDAPLS 427 GTAIDQG+AYGLMLLAL LTY IHTFD PL+ Sbjct: 44 GTAIDQGVAYGLMLLALVLTYLIHTFDTPLN 74 >gb|EYU40039.1| hypothetical protein MIMGU_mgv1a020427mg [Erythranthe guttata] Length = 82 Score = 56.6 bits (135), Expect = 8e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 519 GTAIDQGIAYGLMLLALALTYFIHTFDAP 433 GTAIDQGIAYGLM+LAL LTY IHTFDAP Sbjct: 51 GTAIDQGIAYGLMVLALVLTYLIHTFDAP 79