BLASTX nr result
ID: Rehmannia27_contig00014197
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00014197 (1593 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093222.1| PREDICTED: uncharacterized protein LOC105173... 44 1e-06 >ref|XP_011093222.1| PREDICTED: uncharacterized protein LOC105173237 [Sesamum indicum] Length = 252 Score = 43.5 bits (101), Expect(2) = 1e-06 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -1 Query: 957 VFLMEEKEEDRRVGQLLHTLSKGINDK 877 VFLME KEEDR VG+ L+T+SKGI+DK Sbjct: 117 VFLMEMKEEDRTVGESLYTISKGIHDK 143 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 17/33 (51%), Positives = 21/33 (63%) Frame = -3 Query: 1141 GTPSFSVKTIRYVGFRGIYYISSVGRRNGKDWV 1043 G SFS + + Y G G+YY SS+GRR G D V Sbjct: 85 GVHSFSFQRVAYGGLDGVYYTSSIGRRTGGDGV 117