BLASTX nr result
ID: Rehmannia27_contig00014161
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00014161 (549 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306038.2| hypothetical protein POPTR_0004s12230g [Popu... 44 8e-06 >ref|XP_002306038.2| hypothetical protein POPTR_0004s12230g [Populus trichocarpa] gi|550340886|gb|EEE86549.2| hypothetical protein POPTR_0004s12230g [Populus trichocarpa] Length = 454 Score = 44.3 bits (103), Expect(2) = 8e-06 Identities = 20/35 (57%), Positives = 27/35 (77%) Frame = -1 Query: 357 TQKVIFDMLSKINITSKLAD*EIFNSSYDLEPGHY 253 TQK+IFD++ K N +K+AD I NS+YDLEPG + Sbjct: 193 TQKIIFDLMVKTNEAAKMADRIISNSAYDLEPGAF 227 Score = 32.0 bits (71), Expect(2) = 8e-06 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -3 Query: 268 GAGSLFPNIRPVGPLLVSNGL 206 GA SL PNI P+GPLL SN L Sbjct: 225 GAFSLAPNILPIGPLLASNRL 245