BLASTX nr result
ID: Rehmannia27_contig00014037
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00014037 (581 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP50827.1| Retrovirus-related Pol polyprotein from transposo... 58 4e-07 emb|CAN72171.1| hypothetical protein VITISV_036207 [Vitis vinifera] 59 4e-07 gb|KYP48154.1| Retrovirus-related Pol polyprotein from transposo... 58 5e-07 emb|CAN73119.1| hypothetical protein VITISV_020442 [Vitis vinifera] 58 1e-06 gb|KYP66080.1| Retrovirus-related Pol polyprotein from transposo... 58 1e-06 emb|CAN76580.1| hypothetical protein VITISV_025642 [Vitis vinifera] 58 1e-06 gb|KYP36589.1| Retrovirus-related Pol polyprotein from transposo... 58 1e-06 gb|KYP54652.1| Retrovirus-related Pol polyprotein from transposo... 58 1e-06 gb|KYP64289.1| Retrovirus-related Pol polyprotein from transposo... 58 1e-06 gb|KYP64290.1| Retrovirus-related Pol polyprotein from transposo... 58 2e-06 gb|AAR13298.1| gag-pol polyprotein [Phaseolus vulgaris] 56 5e-06 >gb|KYP50827.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 188 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 580 VKSELNLADPLTKPLGRKLINETSRGMGLKP 488 VKSE NLADPLTKPLGRK+I ETSRGMGLKP Sbjct: 146 VKSEGNLADPLTKPLGRKMIYETSRGMGLKP 176 >emb|CAN72171.1| hypothetical protein VITISV_036207 [Vitis vinifera] Length = 1096 Score = 59.3 bits (142), Expect = 4e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 580 VKSELNLADPLTKPLGRKLINETSRGMGLKPT*EINSDRNPTF 452 V+S+LNLAD LTKPL +KL+ ETSRGMGL P E+ S NPT+ Sbjct: 1054 VRSKLNLADSLTKPLNKKLVEETSRGMGLMPITEVKSCGNPTY 1096 >gb|KYP48154.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 223 Score = 57.8 bits (138), Expect = 5e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 580 VKSELNLADPLTKPLGRKLINETSRGMGLKP 488 VKSE NLADPLTKPLGRK+I ETSRGMGLKP Sbjct: 187 VKSEGNLADPLTKPLGRKMIYETSRGMGLKP 217 >emb|CAN73119.1| hypothetical protein VITISV_020442 [Vitis vinifera] Length = 588 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -2 Query: 580 VKSELNLADPLTKPLGRKLINETSRGMGLKPT*EINSDRNPTF 452 VKSELNL +P TKPL +KL+ ETSR MGL P E+ S NPT+ Sbjct: 546 VKSELNLVNPFTKPLNKKLVEETSREMGLMPIIEVKSGSNPTY 588 >gb|KYP66080.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 316 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 580 VKSELNLADPLTKPLGRKLINETSRGMGLKP 488 VKSE NLADPLTKPLGRK+I ETSRGMGLKP Sbjct: 274 VKSEGNLADPLTKPLGRKMIYETSRGMGLKP 304 >emb|CAN76580.1| hypothetical protein VITISV_025642 [Vitis vinifera] Length = 1046 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -2 Query: 580 VKSELNLADPLTKPLGRKLINETSRGMGLKPT*EINSDRNPTF 452 +++ LNLADPLTKPL +KL+ ETSR MGL P E+ S NPTF Sbjct: 1004 LETRLNLADPLTKPLNKKLVEETSREMGLMPITEVQSGGNPTF 1046 >gb|KYP36589.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 655 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 580 VKSELNLADPLTKPLGRKLINETSRGMGLKP 488 VKSE NLADPLTKPLGRK+I ETSRGMGLKP Sbjct: 616 VKSEGNLADPLTKPLGRKMIYETSRGMGLKP 646 >gb|KYP54652.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 900 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 580 VKSELNLADPLTKPLGRKLINETSRGMGLKP 488 VKSE NLADPLTKPLGRK+I ETSRGMGLKP Sbjct: 858 VKSEGNLADPLTKPLGRKMIYETSRGMGLKP 888 >gb|KYP64289.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 1012 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 580 VKSELNLADPLTKPLGRKLINETSRGMGLKP 488 VKSE NLADPLTKPLGRK+I ETSRGMGLKP Sbjct: 970 VKSEGNLADPLTKPLGRKMIYETSRGMGLKP 1000 >gb|KYP64290.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1215 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 580 VKSELNLADPLTKPLGRKLINETSRGMGLKP 488 VKSE NLADPLTKPLGRK+I ETSRGMGLKP Sbjct: 1173 VKSEGNLADPLTKPLGRKMIYETSRGMGLKP 1203 >gb|AAR13298.1| gag-pol polyprotein [Phaseolus vulgaris] Length = 1290 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 580 VKSELNLADPLTKPLGRKLINETSRGMGLKP 488 VKSE +LADPLTKPLGRK+I ETSRGMGLKP Sbjct: 1248 VKSERDLADPLTKPLGRKMILETSRGMGLKP 1278