BLASTX nr result
ID: Rehmannia27_contig00014036
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00014036 (374 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015160591.1| PREDICTED: putative disease resistance prote... 60 3e-09 gb|KYP50827.1| Retrovirus-related Pol polyprotein from transposo... 57 1e-07 gb|KYP48154.1| Retrovirus-related Pol polyprotein from transposo... 57 2e-07 gb|KYP66080.1| Retrovirus-related Pol polyprotein from transposo... 57 3e-07 gb|KYP54652.1| Retrovirus-related Pol polyprotein from transposo... 57 4e-07 gb|KYP64289.1| Retrovirus-related Pol polyprotein from transposo... 57 4e-07 gb|KYP64290.1| Retrovirus-related Pol polyprotein from transposo... 57 4e-07 gb|AAR13298.1| gag-pol polyprotein [Phaseolus vulgaris] 56 8e-07 gb|KYP36589.1| Retrovirus-related Pol polyprotein from transposo... 55 1e-06 gb|KYP59837.1| Retrovirus-related Pol polyprotein from transposo... 53 9e-06 >ref|XP_015160591.1| PREDICTED: putative disease resistance protein RGA1 [Solanum tuberosum] Length = 146 Score = 60.5 bits (145), Expect = 3e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 374 KNRHTRLRCGLIKQLLKDGVISIDYVKSWMNLANSLTKPSG 252 K+RH +LR ++KQLL+DG+ISIDYVKS MNLA SLTKP G Sbjct: 53 KSRHMKLRHDVVKQLLRDGIISIDYVKSEMNLAYSLTKPVG 93 >gb|KYP50827.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 188 Score = 57.0 bits (136), Expect = 1e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 374 KNRHTRLRCGLIKQLLKDGVISIDYVKSWMNLANSLTKPSG 252 KNRH +LR ++KQLLKDG ISI+YVKS NLA+ LTKP G Sbjct: 121 KNRHIQLRHNIVKQLLKDGTISINYVKSEGNLADPLTKPLG 161 >gb|KYP48154.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 223 Score = 57.0 bits (136), Expect = 2e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 374 KNRHTRLRCGLIKQLLKDGVISIDYVKSWMNLANSLTKPSG 252 KNRH +LR ++KQLLKDG ISI+YVKS NLA+ LTKP G Sbjct: 162 KNRHIQLRHNIVKQLLKDGTISINYVKSEGNLADPLTKPLG 202 >gb|KYP66080.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 316 Score = 57.0 bits (136), Expect = 3e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 374 KNRHTRLRCGLIKQLLKDGVISIDYVKSWMNLANSLTKPSG 252 KNRH +LR ++KQLLKDG ISI+YVKS NLA+ LTKP G Sbjct: 249 KNRHIQLRHNIVKQLLKDGTISINYVKSEGNLADPLTKPLG 289 >gb|KYP54652.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 900 Score = 57.0 bits (136), Expect = 4e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 374 KNRHTRLRCGLIKQLLKDGVISIDYVKSWMNLANSLTKPSG 252 KNRH +LR ++KQLLKDG ISI+YVKS NLA+ LTKP G Sbjct: 833 KNRHIQLRHNIVKQLLKDGTISINYVKSEGNLADPLTKPLG 873 >gb|KYP64289.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 1012 Score = 57.0 bits (136), Expect = 4e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 374 KNRHTRLRCGLIKQLLKDGVISIDYVKSWMNLANSLTKPSG 252 KNRH +LR ++KQLLKDG ISI+YVKS NLA+ LTKP G Sbjct: 945 KNRHIQLRHNIVKQLLKDGTISINYVKSEGNLADPLTKPLG 985 >gb|KYP64290.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1215 Score = 57.0 bits (136), Expect = 4e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 374 KNRHTRLRCGLIKQLLKDGVISIDYVKSWMNLANSLTKPSG 252 KNRH +LR ++KQLLKDG ISI+YVKS NLA+ LTKP G Sbjct: 1148 KNRHIQLRHNIVKQLLKDGTISINYVKSEGNLADPLTKPLG 1188 >gb|AAR13298.1| gag-pol polyprotein [Phaseolus vulgaris] Length = 1290 Score = 56.2 bits (134), Expect = 8e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -1 Query: 374 KNRHTRLRCGLIKQLLKDGVISIDYVKSWMNLANSLTKPSG 252 KNRH +LR L+KQLLK G ISIDYVKS +LA+ LTKP G Sbjct: 1223 KNRHIQLRHNLVKQLLKSGTISIDYVKSERDLADPLTKPLG 1263 >gb|KYP36589.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 655 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -1 Query: 374 KNRHTRLRCGLIKQLLKDGVISIDYVKSWMNLANSLTKPSG 252 KNRH +LR ++K+LLKDG ISI+YVKS NLA+ LTKP G Sbjct: 591 KNRHIQLRHNIVKKLLKDGTISINYVKSEGNLADPLTKPLG 631 >gb|KYP59837.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 258 Score = 52.8 bits (125), Expect = 9e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 374 KNRHTRLRCGLIKQLLKDGVISIDYVKSWMNLANSLTKP 258 KNRH +LR ++KQLLKDG ISI+YVKS NLA+ TKP Sbjct: 191 KNRHIQLRHNIVKQLLKDGTISINYVKSEGNLADPPTKP 229