BLASTX nr result
ID: Rehmannia27_contig00013292
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00013292 (374 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073067.1| PREDICTED: strictosidine-O-beta-D-glucosidas... 54 5e-06 >ref|XP_011073067.1| PREDICTED: strictosidine-O-beta-D-glucosidase-like [Sesamum indicum] Length = 565 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%) Frame = -3 Query: 303 KDWNVLLNCWRSNISKVVVNRSSINTRGEYKIVRPENEEGVIDVEKDKQKSGRISLIMVC 124 KD + N + + + + ++ + +YK+ + +D + K ++ ++ Sbjct: 421 KDLLLYTNKTYKPLPPIYITENGVDEKSDYKLTA---SDACVDPVRVKYHQDHLANVLK- 476 Query: 123 DT*PNK*SLHNTESHVKIRGL---TWCDNFEWADGYTARFGIIY 1 ++H+ E+ V +RG +WCDNFEW++GYT RFG+IY Sbjct: 477 -------AMHDPENPVDVRGYYVWSWCDNFEWSEGYTVRFGLIY 513