BLASTX nr result
ID: Rehmannia27_contig00011602
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00011602 (453 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093161.1| PREDICTED: acyl-coenzyme A thioesterase 13 [... 59 6e-08 ref|XP_012840158.1| PREDICTED: uncharacterized protein LOC105960... 55 7e-07 >ref|XP_011093161.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Sesamum indicum] Length = 175 Score = 58.5 bits (140), Expect = 6e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 2 KNLTVVEVIFRLKESGRLAFTSRATFYNMPVSSL 103 +NLTVV V FRLKESGRLAF +RATFYNMPVSSL Sbjct: 142 RNLTVVAVNFRLKESGRLAFLTRATFYNMPVSSL 175 >ref|XP_012840158.1| PREDICTED: uncharacterized protein LOC105960518 [Erythranthe guttata] gi|604329913|gb|EYU35070.1| hypothetical protein MIMGU_mgv1a015115mg [Erythranthe guttata] Length = 167 Score = 55.5 bits (132), Expect = 7e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 2 KNLTVVEVIFRLKESGRLAFTSRATFYNMPVSSL 103 +NLTVV V FRLK+SG+LAF +RATFYNMPVSSL Sbjct: 134 RNLTVVAVNFRLKKSGQLAFLTRATFYNMPVSSL 167