BLASTX nr result
ID: Rehmannia27_contig00011022
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00011022 (403 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012829544.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-20 ref|XP_011101111.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-20 gb|KDO85079.1| hypothetical protein CISIN_1g0057291mg, partial [... 85 5e-19 ref|XP_006473771.1| PREDICTED: pentatricopeptide repeat-containi... 83 3e-18 ref|XP_004244963.1| PREDICTED: pentatricopeptide repeat-containi... 89 4e-18 ref|XP_015085397.1| PREDICTED: pentatricopeptide repeat-containi... 89 4e-18 emb|CDP07298.1| unnamed protein product [Coffea canephora] 88 7e-18 ref|XP_011041249.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-17 ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Popu... 88 1e-17 ref|XP_006346695.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-17 ref|XP_009784787.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-17 ref|XP_009606848.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-17 gb|KCW70313.1| hypothetical protein EUGRSUZ_F03554 [Eucalyptus g... 81 2e-17 ref|XP_010266137.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-17 ref|XP_004500883.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-17 ref|XP_006435342.1| hypothetical protein CICLE_v10000451mg [Citr... 85 8e-17 ref|XP_009336548.1| PREDICTED: pentatricopeptide repeat-containi... 84 9e-17 gb|KYP47801.1| hypothetical protein KK1_030565 [Cajanus cajan] 85 1e-16 gb|KHN33805.1| Pentatricopeptide repeat-containing protein, mito... 85 1e-16 gb|KHN20117.1| Pentatricopeptide repeat-containing protein, mito... 85 1e-16 >ref|XP_012829544.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Erythranthe guttata] gi|604297234|gb|EYU17498.1| hypothetical protein MIMGU_mgv1a002335mg [Erythranthe guttata] Length = 687 Score = 96.3 bits (238), Expect = 1e-20 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLRL 254 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSAL+YMKSTL+L Sbjct: 638 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSTLKL 687 >ref|XP_011101111.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Sesamum indicum] Length = 689 Score = 96.3 bits (238), Expect = 1e-20 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLRL 254 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSAL+YMKSTL+L Sbjct: 640 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSTLKL 689 >gb|KDO85079.1| hypothetical protein CISIN_1g0057291mg, partial [Citrus sinensis] Length = 111 Score = 85.1 bits (209), Expect = 5e-19 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLR 257 TLMKALIRV+K+ KVPAV+EEM+LSGC PDRKARAMLRSAL+YMK TL+ Sbjct: 62 TLMKALIRVDKFHKVPAVYEEMILSGCTPDRKARAMLRSALRYMKQTLK 110 >ref|XP_006473771.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Citrus sinensis] gi|568839606|ref|XP_006473772.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Citrus sinensis] Length = 99 Score = 82.8 bits (203), Expect = 3e-18 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLR 257 TLMKALIRV+K+ KVPAV+EEM+ SGC PDRKARAMLRSAL+YMK TL+ Sbjct: 50 TLMKALIRVDKFHKVPAVYEEMISSGCTPDRKARAMLRSALRYMKQTLK 98 >ref|XP_004244963.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Solanum lycopersicum] Length = 699 Score = 89.0 bits (219), Expect = 4e-18 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLRL 254 TLMK LIRVEK+E+VPAV+EEMLLSGC PDRKARAMLRSAL+YMKSTL+L Sbjct: 650 TLMKTLIRVEKFERVPAVYEEMLLSGCIPDRKARAMLRSALRYMKSTLKL 699 >ref|XP_015085397.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Solanum pennellii] Length = 700 Score = 89.0 bits (219), Expect = 4e-18 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLRL 254 TLMK LIRVEK+E+VPAV+EEMLLSGC PDRKARAMLRSAL+YMKSTL+L Sbjct: 651 TLMKTLIRVEKFERVPAVYEEMLLSGCIPDRKARAMLRSALRYMKSTLKL 700 >emb|CDP07298.1| unnamed protein product [Coffea canephora] Length = 735 Score = 88.2 bits (217), Expect = 7e-18 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLRL 254 TLMKALIRVEK+EKVPAV+EEML SGC PDRKARAMLRSAL+YMKSTL++ Sbjct: 686 TLMKALIRVEKFEKVPAVYEEMLSSGCLPDRKARAMLRSALRYMKSTLKV 735 >ref|XP_011041249.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Populus euphratica] Length = 701 Score = 87.8 bits (216), Expect = 1e-17 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLRL 254 TLMKALIRVEK++KVP+V+EEM+LSGC PDRKARAMLRSALKYMK TL L Sbjct: 652 TLMKALIRVEKFDKVPSVYEEMILSGCTPDRKARAMLRSALKYMKQTLEL 701 >ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa] gi|222856421|gb|EEE93968.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa] Length = 709 Score = 87.8 bits (216), Expect = 1e-17 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLRL 254 TLMKALIRVEK++KVP+V+EEM+LSGC PDRKARAMLRSALKYMK TL L Sbjct: 660 TLMKALIRVEKFDKVPSVYEEMILSGCTPDRKARAMLRSALKYMKQTLEL 709 >ref|XP_006346695.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Solanum tuberosum] Length = 697 Score = 87.0 bits (214), Expect = 2e-17 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLRL 254 TLMK LIRVEK+E+VPAV+EEMLL GC PDRKARAMLRSAL+YMKSTL+L Sbjct: 648 TLMKTLIRVEKFERVPAVYEEMLLCGCIPDRKARAMLRSALRYMKSTLKL 697 >ref|XP_009784787.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Nicotiana sylvestris] gi|698474688|ref|XP_009784788.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Nicotiana sylvestris] Length = 710 Score = 87.0 bits (214), Expect = 2e-17 Identities = 41/49 (83%), Positives = 48/49 (97%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLR 257 TLMKALIRV+K+E+VPAV+EEMLLSGC PDRKARAMLRSAL+Y+KSTL+ Sbjct: 662 TLMKALIRVDKFERVPAVYEEMLLSGCTPDRKARAMLRSALRYLKSTLK 710 >ref|XP_009606848.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Nicotiana tomentosiformis] gi|697106032|ref|XP_009606849.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Nicotiana tomentosiformis] Length = 710 Score = 87.0 bits (214), Expect = 2e-17 Identities = 41/49 (83%), Positives = 48/49 (97%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLR 257 TLMKALIRV+K+E+VPAV+EEMLLSGC PDRKARAMLRSAL+Y+KSTL+ Sbjct: 662 TLMKALIRVDKFERVPAVYEEMLLSGCTPDRKARAMLRSALRYLKSTLK 710 >gb|KCW70313.1| hypothetical protein EUGRSUZ_F03554 [Eucalyptus grandis] Length = 111 Score = 80.9 bits (198), Expect = 2e-17 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLR 257 TLMK LIRV+K++KVP V+EEM++SGC PDRKARAMLRSAL+YM+ TLR Sbjct: 61 TLMKVLIRVDKFQKVPEVYEEMIVSGCMPDRKARAMLRSALRYMRQTLR 109 >ref|XP_010266137.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Nelumbo nucifera] gi|720032527|ref|XP_010266139.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Nelumbo nucifera] Length = 691 Score = 86.7 bits (213), Expect = 2e-17 Identities = 40/49 (81%), Positives = 47/49 (95%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLR 257 TLMKALIRVEK+EKVPA++E+M+LSGC PDRKARAMLRSAL+YM+ TLR Sbjct: 642 TLMKALIRVEKFEKVPAIYEDMILSGCTPDRKARAMLRSALRYMRQTLR 690 >ref|XP_004500883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Cicer arietinum] Length = 691 Score = 86.7 bits (213), Expect = 2e-17 Identities = 41/49 (83%), Positives = 47/49 (95%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLR 257 TLMK+LIRV+KY KVPAV+EEM++SGCAPDRKARAMLRSAL+YMK TLR Sbjct: 642 TLMKSLIRVDKYPKVPAVYEEMVMSGCAPDRKARAMLRSALRYMKQTLR 690 >ref|XP_006435342.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|567885569|ref|XP_006435343.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|557537464|gb|ESR48582.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|557537465|gb|ESR48583.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] Length = 704 Score = 85.1 bits (209), Expect = 8e-17 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLR 257 TLMKALIRV+K+ KVPAV+EEM+LSGC PDRKARAMLRSAL+YMK TL+ Sbjct: 655 TLMKALIRVDKFHKVPAVYEEMILSGCTPDRKARAMLRSALRYMKQTLK 703 >ref|XP_009336548.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Pyrus x bretschneideri] Length = 378 Score = 84.3 bits (207), Expect = 9e-17 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLR 257 TLMK LIRV+K+ KVPAV+EEM++SGC PDRKARAMLRSALKYMK TLR Sbjct: 329 TLMKTLIRVDKFYKVPAVYEEMIMSGCTPDRKARAMLRSALKYMKQTLR 377 >gb|KYP47801.1| hypothetical protein KK1_030565 [Cajanus cajan] Length = 489 Score = 84.7 bits (208), Expect = 1e-16 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLR 257 TLMKALIRVEK++KVPAV+EEM+ SGC PDRKARAMLRSAL+YMK TL+ Sbjct: 440 TLMKALIRVEKFQKVPAVYEEMVTSGCTPDRKARAMLRSALRYMKQTLK 488 >gb|KHN33805.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 489 Score = 84.7 bits (208), Expect = 1e-16 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLR 257 TLMKALIRVEK++KVPAV+EEM+ SGC PDRKARAMLRSAL+YMK TL+ Sbjct: 440 TLMKALIRVEKFQKVPAVYEEMVASGCTPDRKARAMLRSALRYMKQTLK 488 >gb|KHN20117.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 613 Score = 84.7 bits (208), Expect = 1e-16 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -1 Query: 403 TLMKALIRVEKYEKVPAVFEEMLLSGCAPDRKARAMLRSALKYMKSTLR 257 TLMKALIRVEK++KVPAV+EEM+ SGC PDRKARAMLRSAL+YMK TL+ Sbjct: 564 TLMKALIRVEKFQKVPAVYEEMVTSGCTPDRKARAMLRSALRYMKQTLK 612