BLASTX nr result
ID: Rehmannia27_contig00010691
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00010691 (474 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012830305.1| PREDICTED: trihelix transcription factor ASI... 57 1e-06 ref|XP_011085990.1| PREDICTED: trihelix transcription factor ASI... 56 2e-06 ref|XP_012849011.1| PREDICTED: trihelix transcription factor ASI... 55 5e-06 >ref|XP_012830305.1| PREDICTED: trihelix transcription factor ASIL2-like isoform X1 [Erythranthe guttata] gi|604344582|gb|EYU43336.1| hypothetical protein MIMGU_mgv1a010263mg [Erythranthe guttata] Length = 317 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 QRMRLFMDTQVQLEKLKQAKRSGSSGDIYS 92 QRMRLFMDTQVQLEK+KQAKRSGS+ DIYS Sbjct: 288 QRMRLFMDTQVQLEKIKQAKRSGSNDDIYS 317 >ref|XP_011085990.1| PREDICTED: trihelix transcription factor ASIL1-like [Sesamum indicum] Length = 309 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 QRMRLFMDTQVQLEKLKQAKRSGSSGDIYS 92 QRMRLFMDTQVQLEK+KQAKRSGS DIYS Sbjct: 280 QRMRLFMDTQVQLEKIKQAKRSGSPDDIYS 309 >ref|XP_012849011.1| PREDICTED: trihelix transcription factor ASIL2-like [Erythranthe guttata] gi|604315379|gb|EYU28085.1| hypothetical protein MIMGU_mgv1a010659mg [Erythranthe guttata] Length = 306 Score = 54.7 bits (130), Expect = 5e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 3 QRMRLFMDTQVQLEKLKQAKRSGSSGDIYS 92 QRM+LFMDTQ+QL+K+KQAKRSGSS DIYS Sbjct: 277 QRMQLFMDTQIQLQKIKQAKRSGSSDDIYS 306