BLASTX nr result
ID: Rehmannia27_contig00010161
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00010161 (517 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843714.1| PREDICTED: AT-hook motif nuclear-localized p... 60 7e-08 ref|XP_011092042.1| PREDICTED: uncharacterized protein LOC105172... 55 7e-06 >ref|XP_012843714.1| PREDICTED: AT-hook motif nuclear-localized protein 11 isoform X1 [Erythranthe guttata] Length = 328 Score = 60.5 bits (145), Expect = 7e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 99 QSKCMDQRESMTFTGSASYYVHQGTAESVTGLQ 1 +SKCMDQRE+M+ TGSASYY+H GTAESVTGLQ Sbjct: 15 KSKCMDQREAMSLTGSASYYMHPGTAESVTGLQ 47 >ref|XP_011092042.1| PREDICTED: uncharacterized protein LOC105172351 [Sesamum indicum] Length = 310 Score = 54.7 bits (130), Expect = 7e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -2 Query: 87 MDQRESMTFTGSASYYVHQGTAESVTGLQ 1 MDQRESM TGSASYYVH GTAESVTGLQ Sbjct: 1 MDQRESMQLTGSASYYVHPGTAESVTGLQ 29