BLASTX nr result
ID: Rehmannia27_contig00010035
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00010035 (414 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074161.1| PREDICTED: ethylene-responsive transcription... 64 2e-09 ref|XP_012838916.1| PREDICTED: ethylene-responsive transcription... 56 9e-07 ref|XP_011098323.1| PREDICTED: ethylene-responsive transcription... 55 2e-06 >ref|XP_011074161.1| PREDICTED: ethylene-responsive transcription factor RAP2-13 [Sesamum indicum] Length = 330 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 159 MAATMDFWSSTPVVDPFNGGELMEALEPFMKSA 257 MAATMDFWSS+PVVDP GGELME LEPFMKSA Sbjct: 1 MAATMDFWSSSPVVDPLGGGELMEVLEPFMKSA 33 >ref|XP_012838916.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Erythranthe guttata] gi|604331659|gb|EYU36517.1| hypothetical protein MIMGU_mgv1a009828mg [Erythranthe guttata] Length = 330 Score = 56.2 bits (134), Expect = 9e-07 Identities = 28/35 (80%), Positives = 30/35 (85%), Gaps = 2/35 (5%) Frame = +3 Query: 159 MAATMDFWSSTP--VVDPFNGGELMEALEPFMKSA 257 MAAT+DFWSS+ VVDPFNGGELMEAL PFMK A Sbjct: 1 MAATLDFWSSSEPVVVDPFNGGELMEALGPFMKRA 35 >ref|XP_011098323.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like [Sesamum indicum] Length = 343 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +3 Query: 159 MAATMDFWSS-TPVVDPFNGGELMEALEPFMKSA 257 M + DFWSS TP VD FNGGELMEALEPFMKSA Sbjct: 1 MGTSTDFWSSGTPFVDSFNGGELMEALEPFMKSA 34