BLASTX nr result
ID: Rehmannia27_contig00009939
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00009939 (600 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH12953.1| hypothetical protein GLYMA_15G207500 [Glycine max] 52 7e-06 >gb|KRH12953.1| hypothetical protein GLYMA_15G207500 [Glycine max] Length = 66 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 247 FSHGQLYVVVSRVTYRKSLKILVCDDGKIKSNRRIMLCIKKYSKI 381 FSHGQLYV + RVT K LKIL+C+D + SN + + I+KY KI Sbjct: 22 FSHGQLYVTILRVTKCKRLKILICNDEEDNSNMTLNVVIEKYFKI 66