BLASTX nr result
ID: Rehmannia27_contig00009871
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00009871 (486 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009339558.1| PREDICTED: peroxisomal nicotinamide adenine ... 61 5e-09 ref|XP_012843050.1| PREDICTED: peroxisomal nicotinamide adenine ... 62 2e-08 ref|XP_006344268.1| PREDICTED: peroxisomal nicotinamide adenine ... 62 2e-08 ref|XP_004237037.1| PREDICTED: peroxisomal nicotinamide adenine ... 62 2e-08 ref|XP_012843049.1| PREDICTED: peroxisomal nicotinamide adenine ... 62 2e-08 ref|XP_011089771.1| PREDICTED: peroxisomal nicotinamide adenine ... 62 2e-08 ref|XP_006494419.1| PREDICTED: peroxisomal nicotinamide adenine ... 59 2e-07 ref|XP_006435522.1| hypothetical protein CICLE_v10001647mg [Citr... 59 2e-07 ref|XP_010932198.1| PREDICTED: peroxisomal nicotinamide adenine ... 59 2e-07 ref|XP_010932196.1| PREDICTED: peroxisomal nicotinamide adenine ... 59 2e-07 gb|KVI03205.1| Mitochondrial carrier domain-containing protein [... 59 2e-07 ref|XP_015880005.1| PREDICTED: peroxisomal nicotinamide adenine ... 59 2e-07 emb|CDP07232.1| unnamed protein product [Coffea canephora] 59 2e-07 ref|XP_010932195.1| PREDICTED: peroxisomal nicotinamide adenine ... 59 2e-07 ref|XP_012073516.1| PREDICTED: peroxisomal nicotinamide adenine ... 59 2e-07 ref|XP_010266331.1| PREDICTED: peroxisomal nicotinamide adenine ... 59 3e-07 ref|XP_010266330.1| PREDICTED: peroxisomal nicotinamide adenine ... 59 3e-07 ref|XP_007208793.1| hypothetical protein PRUPE_ppa024367mg [Prun... 59 3e-07 ref|XP_008233414.1| PREDICTED: peroxisomal nicotinamide adenine ... 59 3e-07 ref|XP_007011448.1| Mitochondrial substrate carrier family prote... 59 3e-07 >ref|XP_009339558.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like [Pyrus x bretschneideri] Length = 154 Score = 61.2 bits (147), Expect = 5e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQVP 96 M SWL+VAA AGS+NVLLTNPIWVLVTRMQVP Sbjct: 114 MFSWLLVAAFAGSLNVLLTNPIWVLVTRMQVP 145 >ref|XP_012843050.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like isoform X2 [Erythranthe guttata] Length = 300 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 MLSWL+VAALAGSVNVLLTNPIWVLVTRMQ Sbjct: 57 MLSWLVVAALAGSVNVLLTNPIWVLVTRMQ 86 >ref|XP_006344268.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like [Solanum tuberosum] gi|565354744|ref|XP_006344269.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like [Solanum tuberosum] Length = 350 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 MLSWL+VAALAGSVNVLLTNPIWVLVTRMQ Sbjct: 112 MLSWLVVAALAGSVNVLLTNPIWVLVTRMQ 141 >ref|XP_004237037.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier [Solanum lycopersicum] gi|460382625|ref|XP_004237038.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier [Solanum lycopersicum] gi|460382627|ref|XP_004237039.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier [Solanum lycopersicum] gi|970024868|ref|XP_015073742.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like [Solanum pennellii] gi|970024870|ref|XP_015073743.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like [Solanum pennellii] gi|970024872|ref|XP_015073744.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like [Solanum pennellii] gi|970024874|ref|XP_015073746.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like [Solanum pennellii] Length = 350 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 MLSWL+VAALAGSVNVLLTNPIWVLVTRMQ Sbjct: 112 MLSWLVVAALAGSVNVLLTNPIWVLVTRMQ 141 >ref|XP_012843049.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like isoform X1 [Erythranthe guttata] gi|604322426|gb|EYU32812.1| hypothetical protein MIMGU_mgv1a009000mg [Erythranthe guttata] Length = 356 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 MLSWL+VAALAGSVNVLLTNPIWVLVTRMQ Sbjct: 113 MLSWLVVAALAGSVNVLLTNPIWVLVTRMQ 142 >ref|XP_011089771.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like [Sesamum indicum] Length = 358 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 MLSWL+VAALAGSVNVLLTNPIWVLVTRMQ Sbjct: 118 MLSWLVVAALAGSVNVLLTNPIWVLVTRMQ 147 >ref|XP_006494419.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier [Citrus sinensis] gi|641866660|gb|KDO85345.1| hypothetical protein CISIN_1g018422mg [Citrus sinensis] Length = 356 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 M SWLIVAALAGS+NVLLTNPIWVLVTRMQ Sbjct: 117 MFSWLIVAALAGSLNVLLTNPIWVLVTRMQ 146 >ref|XP_006435522.1| hypothetical protein CICLE_v10001647mg [Citrus clementina] gi|557537644|gb|ESR48762.1| hypothetical protein CICLE_v10001647mg [Citrus clementina] Length = 356 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 M SWLIVAALAGS+NVLLTNPIWVLVTRMQ Sbjct: 117 MFSWLIVAALAGSLNVLLTNPIWVLVTRMQ 146 >ref|XP_010932198.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like isoform X3 [Elaeis guineensis] Length = 308 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 M SWL+VAA+AGSVNVLLTNPIWVLVTRMQ Sbjct: 123 MFSWLVVAAVAGSVNVLLTNPIWVLVTRMQ 152 >ref|XP_010932196.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like isoform X2 [Elaeis guineensis] Length = 331 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 M SWL+VAA+AGSVNVLLTNPIWVLVTRMQ Sbjct: 123 MFSWLVVAAVAGSVNVLLTNPIWVLVTRMQ 152 >gb|KVI03205.1| Mitochondrial carrier domain-containing protein [Cynara cardunculus var. scolymus] Length = 357 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 M SWL+VAALAGS+NVLLTNPIWVLVTRMQ Sbjct: 114 MFSWLVVAALAGSLNVLLTNPIWVLVTRMQ 143 >ref|XP_015880005.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like [Ziziphus jujuba] Length = 362 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 M+SWL+VAA+AGS+NVLLTNPIWVLVTRMQ Sbjct: 119 MISWLVVAAIAGSLNVLLTNPIWVLVTRMQ 148 >emb|CDP07232.1| unnamed protein product [Coffea canephora] Length = 363 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 M SWL+VAALAGS+NVLLTNPIWVLVTRMQ Sbjct: 121 MFSWLVVAALAGSLNVLLTNPIWVLVTRMQ 150 >ref|XP_010932195.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like isoform X1 [Elaeis guineensis] Length = 367 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 M SWL+VAA+AGSVNVLLTNPIWVLVTRMQ Sbjct: 123 MFSWLVVAAVAGSVNVLLTNPIWVLVTRMQ 152 >ref|XP_012073516.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like [Jatropha curcas] gi|643728767|gb|KDP36704.1| hypothetical protein JCGZ_07995 [Jatropha curcas] Length = 370 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 M SWL+VAALAGS+NVLLTNPIWVLVTRMQ Sbjct: 127 MFSWLVVAALAGSLNVLLTNPIWVLVTRMQ 156 >ref|XP_010266331.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like isoform X3 [Nelumbo nucifera] Length = 305 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 ML+WL+VAA+AGS+NVLLTNPIWVLVTRMQ Sbjct: 124 MLTWLVVAAIAGSLNVLLTNPIWVLVTRMQ 153 >ref|XP_010266330.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like isoform X2 [Nelumbo nucifera] Length = 308 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 ML+WL+VAA+AGS+NVLLTNPIWVLVTRMQ Sbjct: 124 MLTWLVVAAIAGSLNVLLTNPIWVLVTRMQ 153 >ref|XP_007208793.1| hypothetical protein PRUPE_ppa024367mg [Prunus persica] gi|462404528|gb|EMJ09992.1| hypothetical protein PRUPE_ppa024367mg [Prunus persica] Length = 332 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 M SWL+VAALAGS+NVLLTNPIWVLVTRMQ Sbjct: 89 MFSWLLVAALAGSLNVLLTNPIWVLVTRMQ 118 >ref|XP_008233414.1| PREDICTED: peroxisomal nicotinamide adenine dinucleotide carrier-like [Prunus mume] Length = 357 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 M SWL+VAALAGS+NVLLTNPIWVLVTRMQ Sbjct: 114 MFSWLLVAALAGSLNVLLTNPIWVLVTRMQ 143 >ref|XP_007011448.1| Mitochondrial substrate carrier family protein [Theobroma cacao] gi|508728361|gb|EOY20258.1| Mitochondrial substrate carrier family protein [Theobroma cacao] Length = 357 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 MLSWLIVAALAGSVNVLLTNPIWVLVTRMQ 90 M SWL+VAALAGS+NVLLTNPIWVLVTRMQ Sbjct: 115 MFSWLLVAALAGSLNVLLTNPIWVLVTRMQ 144