BLASTX nr result
ID: Rehmannia27_contig00009415
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00009415 (500 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092835.1| PREDICTED: mitochondrial import inner membra... 100 2e-24 ref|XP_008792086.1| PREDICTED: mitochondrial import inner membra... 97 4e-23 ref|XP_012830994.1| PREDICTED: mitochondrial import inner membra... 97 4e-23 ref|XP_009384310.1| PREDICTED: mitochondrial import inner membra... 96 1e-22 ref|XP_011653595.1| PREDICTED: mitochondrial import inner membra... 95 2e-22 ref|XP_008449278.1| PREDICTED: mitochondrial import inner membra... 95 2e-22 ref|XP_015965655.1| PREDICTED: mitochondrial import inner membra... 94 3e-22 gb|EPS66738.1| hypothetical protein M569_08041, partial [Genlise... 94 3e-22 ref|XP_011624522.1| PREDICTED: mitochondrial import inner membra... 94 4e-22 ref|XP_009590378.1| PREDICTED: mitochondrial import inner membra... 94 4e-22 gb|ERN09199.1| hypothetical protein AMTR_s00014p00248230 [Ambore... 94 4e-22 ref|XP_002279532.1| PREDICTED: mitochondrial import inner membra... 94 5e-22 ref|XP_012086854.1| PREDICTED: mitochondrial import inner membra... 94 5e-22 ref|XP_009387135.1| PREDICTED: mitochondrial import inner membra... 94 7e-22 gb|KYP58020.1| DnaJ isogeny subfamily C member 15, partial [Caja... 94 7e-22 emb|CBI32694.3| unnamed protein product [Vitis vinifera] 94 8e-22 ref|XP_015949995.1| PREDICTED: mitochondrial import inner membra... 93 9e-22 gb|KDO36539.1| hypothetical protein CISIN_1g040731mg, partial [C... 93 1e-21 ref|XP_008239236.1| PREDICTED: mitochondrial import inner membra... 93 1e-21 ref|XP_006436235.1| hypothetical protein CICLE_v10033118mg [Citr... 93 1e-21 >ref|XP_011092835.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Sesamum indicum] Length = 112 Score = 100 bits (248), Expect = 2e-24 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RESTP DK++EAHRRVMVANHPDAGGSHY+ASKINEAK+VLLGKTKSSDSAF Sbjct: 61 RESTPADKVREAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 112 >ref|XP_008792086.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-2-like [Phoenix dactylifera] Length = 112 Score = 96.7 bits (239), Expect = 4e-23 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RESTPPDKIK+AHR+VMVANHPDAGGSHY+ASKINEAK+VLLGKTK SAF Sbjct: 61 RESTPPDKIKDAHRKVMVANHPDAGGSHYLASKINEAKDVLLGKTKGGGSAF 112 >ref|XP_012830994.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Erythranthe guttata] gi|604343755|gb|EYU42589.1| hypothetical protein MIMGU_mgv1a016665mg [Erythranthe guttata] Length = 112 Score = 96.7 bits (239), Expect = 4e-23 Identities = 43/52 (82%), Positives = 51/52 (98%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RESTP DK++EAHRRVMVANHPDAGGSHY+ASKINEAK++++GK+KSSDSAF Sbjct: 61 RESTPQDKVREAHRRVMVANHPDAGGSHYLASKINEAKDIMMGKSKSSDSAF 112 >ref|XP_009384310.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Musa acuminata subsp. malaccensis] Length = 112 Score = 95.5 bits (236), Expect = 1e-22 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RES PPDK+KEAHR+VMVANHPDAGGSHY+ASKINEAK+VLLGKTK SAF Sbjct: 61 RESAPPDKVKEAHRKVMVANHPDAGGSHYLASKINEAKDVLLGKTKGGGSAF 112 >ref|XP_011653595.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Cucumis sativus] gi|700199026|gb|KGN54184.1| hypothetical protein Csa_4G292450 [Cucumis sativus] Length = 112 Score = 95.1 bits (235), Expect = 2e-22 Identities = 43/52 (82%), Positives = 50/52 (96%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RESTP DK+KEAHR+VMVANHPDAGGSHY+ASKINEAK++LLGKT+ S+SAF Sbjct: 61 RESTPTDKVKEAHRKVMVANHPDAGGSHYLASKINEAKDILLGKTRGSNSAF 112 >ref|XP_008449278.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Cucumis melo] Length = 112 Score = 95.1 bits (235), Expect = 2e-22 Identities = 43/52 (82%), Positives = 50/52 (96%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RESTP DK+KEAHR+VMVANHPDAGGSHY+ASKINEAK++LLGKT+ S+SAF Sbjct: 61 RESTPTDKVKEAHRKVMVANHPDAGGSHYLASKINEAKDILLGKTRGSNSAF 112 >ref|XP_015965655.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Arachis duranensis] Length = 110 Score = 94.4 bits (233), Expect = 3e-22 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RE TP DK+KEAHRRVM+ANHPDAGGSHY+ASKINEAK+VLLGKTK +SAF Sbjct: 59 REHTPTDKVKEAHRRVMIANHPDAGGSHYLASKINEAKDVLLGKTKGGESAF 110 >gb|EPS66738.1| hypothetical protein M569_08041, partial [Genlisea aurea] Length = 110 Score = 94.4 bits (233), Expect = 3e-22 Identities = 42/52 (80%), Positives = 50/52 (96%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RE+T PDKI+EAHRRVM+ANHPD GGSHY+ASKINEAK+V+LGKTK++DSAF Sbjct: 59 RENTAPDKIREAHRRVMIANHPDGGGSHYLASKINEAKDVMLGKTKTTDSAF 110 >ref|XP_011624522.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Amborella trichopoda] Length = 112 Score = 94.4 bits (233), Expect = 4e-22 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RES PDK+KEAHRRVMVANHPDAGGSHY+ASKINEAK+V+LGKTK S SAF Sbjct: 61 RESASPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKGSGSAF 112 >ref|XP_009590378.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Nicotiana tomentosiformis] gi|698579788|ref|XP_009777114.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Nicotiana sylvestris] Length = 112 Score = 94.4 bits (233), Expect = 4e-22 Identities = 42/52 (80%), Positives = 50/52 (96%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RESTPP+K++EAHR+VMVANHPDAGGSHY+ASKINEAK++L GKTK+S SAF Sbjct: 61 RESTPPEKVREAHRKVMVANHPDAGGSHYLASKINEAKDILTGKTKNSGSAF 112 >gb|ERN09199.1| hypothetical protein AMTR_s00014p00248230 [Amborella trichopoda] Length = 113 Score = 94.4 bits (233), Expect = 4e-22 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RES PDK+KEAHRRVMVANHPDAGGSHY+ASKINEAK+V+LGKTK S SAF Sbjct: 62 RESASPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKGSGSAF 113 >ref|XP_002279532.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Vitis vinifera] Length = 110 Score = 94.0 bits (232), Expect = 5e-22 Identities = 42/52 (80%), Positives = 50/52 (96%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RESTP DK+KEAHR+VMVANHPDAGGSHY+ASKINEAK+++LGKT+ S+SAF Sbjct: 59 RESTPADKVKEAHRKVMVANHPDAGGSHYLASKINEAKDMMLGKTRGSESAF 110 >ref|XP_012086854.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Jatropha curcas] Length = 112 Score = 94.0 bits (232), Expect = 5e-22 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RESTP DK+KEAHRRVMVANHPDAGGSHY+ASKINEAK++LLGK K S SAF Sbjct: 61 RESTPTDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDILLGKGKGSGSAF 112 >ref|XP_009387135.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Musa acuminata subsp. malaccensis] Length = 112 Score = 93.6 bits (231), Expect = 7e-22 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RE+ PPDKIKEAH++VMVANHPDAGGSHY+ASKINEAK+VLLGKTK SAF Sbjct: 61 RENAPPDKIKEAHKKVMVANHPDAGGSHYLASKINEAKDVLLGKTKGGGSAF 112 >gb|KYP58020.1| DnaJ isogeny subfamily C member 15, partial [Cajanus cajan] Length = 114 Score = 93.6 bits (231), Expect = 7e-22 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RE TP DKIKEAHRRVMVANHPDAGGSHY+ASKINEAK++LLGKTK SAF Sbjct: 63 RERTPTDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDILLGKTKGGGSAF 114 >emb|CBI32694.3| unnamed protein product [Vitis vinifera] Length = 129 Score = 94.0 bits (232), Expect = 8e-22 Identities = 42/52 (80%), Positives = 50/52 (96%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RESTP DK+KEAHR+VMVANHPDAGGSHY+ASKINEAK+++LGKT+ S+SAF Sbjct: 78 RESTPADKVKEAHRKVMVANHPDAGGSHYLASKINEAKDMMLGKTRGSESAF 129 >ref|XP_015949995.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Arachis duranensis] gi|1012021438|ref|XP_015949997.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Arachis duranensis] gi|1012021442|ref|XP_015949998.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Arachis duranensis] Length = 110 Score = 93.2 bits (230), Expect = 9e-22 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RE TP DK+KEAHRRVM+ANHPDAGGSHY+ASKINEAK+VLLGKTK SAF Sbjct: 59 REHTPTDKVKEAHRRVMIANHPDAGGSHYLASKINEAKDVLLGKTKGGGSAF 110 >gb|KDO36539.1| hypothetical protein CISIN_1g040731mg, partial [Citrus sinensis] Length = 111 Score = 93.2 bits (230), Expect = 1e-21 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RE+ PDK+KEAHRRVMVANHPDAGGSHY+ASKINEAK+V+LGKTK S SAF Sbjct: 60 RENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKGSGSAF 111 >ref|XP_008239236.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Prunus mume] Length = 112 Score = 93.2 bits (230), Expect = 1e-21 Identities = 42/52 (80%), Positives = 49/52 (94%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RESTP DK++EAHRRVMVANHPDAGGSHY+ASKINEAK++LLG+TK + SAF Sbjct: 61 RESTPTDKVREAHRRVMVANHPDAGGSHYLASKINEAKDILLGRTKGTGSAF 112 >ref|XP_006436235.1| hypothetical protein CICLE_v10033118mg [Citrus clementina] gi|568865088|ref|XP_006485915.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Citrus sinensis] gi|557538431|gb|ESR49475.1| hypothetical protein CICLE_v10033118mg [Citrus clementina] Length = 112 Score = 93.2 bits (230), Expect = 1e-21 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -1 Query: 500 RESTPPDKIKEAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKTKSSDSAF 345 RE+ PDK+KEAHRRVMVANHPDAGGSHY+ASKINEAK+V+LGKTK S SAF Sbjct: 61 RENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKGSGSAF 112