BLASTX nr result
ID: Rehmannia27_contig00009332
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00009332 (419 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012829544.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-10 ref|XP_011101111.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-10 gb|KDO85079.1| hypothetical protein CISIN_1g0057291mg, partial [... 61 1e-09 ref|XP_004244963.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-09 ref|XP_015085397.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-09 ref|XP_006473771.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-09 ref|XP_009336548.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-09 gb|KCW70313.1| hypothetical protein EUGRSUZ_F03554 [Eucalyptus g... 60 3e-09 ref|XP_008347337.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-09 ref|XP_004500883.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-09 ref|XP_008377072.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-09 ref|XP_006346695.1| PREDICTED: pentatricopeptide repeat-containi... 63 6e-09 ref|XP_009784787.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-09 ref|XP_009606848.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-09 emb|CDP07298.1| unnamed protein product [Coffea canephora] 62 9e-09 ref|XP_011041249.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-08 ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Popu... 62 1e-08 ref|XP_012437179.1| PREDICTED: ACT domain-containing protein ACR... 58 1e-08 ref|XP_006435342.1| hypothetical protein CICLE_v10000451mg [Citr... 61 2e-08 ref|XP_002510663.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-08 >ref|XP_012829544.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Erythranthe guttata] gi|604297234|gb|EYU17498.1| hypothetical protein MIMGU_mgv1a002335mg [Erythranthe guttata] Length = 687 Score = 67.8 bits (164), Expect = 1e-10 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLRL 105 PAVFEEML+SGCAPDRKARAMLRSAL+YMKSTL+L Sbjct: 653 PAVFEEMLLSGCAPDRKARAMLRSALRYMKSTLKL 687 >ref|XP_011101111.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Sesamum indicum] Length = 689 Score = 67.8 bits (164), Expect = 1e-10 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLRL 105 PAVFEEML+SGCAPDRKARAMLRSAL+YMKSTL+L Sbjct: 655 PAVFEEMLLSGCAPDRKARAMLRSALRYMKSTLKL 689 >gb|KDO85079.1| hypothetical protein CISIN_1g0057291mg, partial [Citrus sinensis] Length = 111 Score = 61.2 bits (147), Expect = 1e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLR 102 PAV+EEM++SGC PDRKARAMLRSAL+YMK TL+ Sbjct: 77 PAVYEEMILSGCTPDRKARAMLRSALRYMKQTLK 110 >ref|XP_004244963.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Solanum lycopersicum] Length = 699 Score = 64.7 bits (156), Expect = 1e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLRL 105 PAV+EEML+SGC PDRKARAMLRSAL+YMKSTL+L Sbjct: 665 PAVYEEMLLSGCIPDRKARAMLRSALRYMKSTLKL 699 >ref|XP_015085397.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Solanum pennellii] Length = 700 Score = 64.7 bits (156), Expect = 1e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLRL 105 PAV+EEML+SGC PDRKARAMLRSAL+YMKSTL+L Sbjct: 666 PAVYEEMLLSGCIPDRKARAMLRSALRYMKSTLKL 700 >ref|XP_006473771.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Citrus sinensis] gi|568839606|ref|XP_006473772.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Citrus sinensis] Length = 99 Score = 60.1 bits (144), Expect = 2e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLR 102 PAV+EEM+ SGC PDRKARAMLRSAL+YMK TL+ Sbjct: 65 PAVYEEMISSGCTPDRKARAMLRSALRYMKQTLK 98 >ref|XP_009336548.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Pyrus x bretschneideri] Length = 378 Score = 63.5 bits (153), Expect = 3e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLR 102 PAV+EEM++SGC PDRKARAMLRSALKYMK TLR Sbjct: 344 PAVYEEMIMSGCTPDRKARAMLRSALKYMKQTLR 377 >gb|KCW70313.1| hypothetical protein EUGRSUZ_F03554 [Eucalyptus grandis] Length = 111 Score = 60.1 bits (144), Expect = 3e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLR 102 P V+EEM+VSGC PDRKARAMLRSAL+YM+ TLR Sbjct: 76 PEVYEEMIVSGCMPDRKARAMLRSALRYMRQTLR 109 >ref|XP_008347337.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like, partial [Malus domestica] Length = 597 Score = 63.5 bits (153), Expect = 3e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLR 102 PAV+EEM++SGC PDRKARAMLRSALKYMK TLR Sbjct: 563 PAVYEEMIMSGCTPDRKARAMLRSALKYMKQTLR 596 >ref|XP_004500883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Cicer arietinum] Length = 691 Score = 63.5 bits (153), Expect = 3e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLR 102 PAV+EEM++SGCAPDRKARAMLRSAL+YMK TLR Sbjct: 657 PAVYEEMVMSGCAPDRKARAMLRSALRYMKQTLR 690 >ref|XP_008377072.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Malus domestica] Length = 721 Score = 63.5 bits (153), Expect = 3e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLR 102 PAV+EEM++SGC PDRKARAMLRSALKYMK TLR Sbjct: 687 PAVYEEMIMSGCTPDRKARAMLRSALKYMKQTLR 720 >ref|XP_006346695.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Solanum tuberosum] Length = 697 Score = 62.8 bits (151), Expect = 6e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLRL 105 PAV+EEML+ GC PDRKARAMLRSAL+YMKSTL+L Sbjct: 663 PAVYEEMLLCGCIPDRKARAMLRSALRYMKSTLKL 697 >ref|XP_009784787.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Nicotiana sylvestris] gi|698474688|ref|XP_009784788.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Nicotiana sylvestris] Length = 710 Score = 62.4 bits (150), Expect = 8e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLR 102 PAV+EEML+SGC PDRKARAMLRSAL+Y+KSTL+ Sbjct: 677 PAVYEEMLLSGCTPDRKARAMLRSALRYLKSTLK 710 >ref|XP_009606848.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Nicotiana tomentosiformis] gi|697106032|ref|XP_009606849.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Nicotiana tomentosiformis] Length = 710 Score = 62.4 bits (150), Expect = 8e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLR 102 PAV+EEML+SGC PDRKARAMLRSAL+Y+KSTL+ Sbjct: 677 PAVYEEMLLSGCTPDRKARAMLRSALRYLKSTLK 710 >emb|CDP07298.1| unnamed protein product [Coffea canephora] Length = 735 Score = 62.4 bits (150), Expect = 9e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLRL 105 PAV+EEML SGC PDRKARAMLRSAL+YMKSTL++ Sbjct: 701 PAVYEEMLSSGCLPDRKARAMLRSALRYMKSTLKV 735 >ref|XP_011041249.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Populus euphratica] Length = 701 Score = 62.0 bits (149), Expect = 1e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLRL 105 P+V+EEM++SGC PDRKARAMLRSALKYMK TL L Sbjct: 667 PSVYEEMILSGCTPDRKARAMLRSALKYMKQTLEL 701 >ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa] gi|222856421|gb|EEE93968.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa] Length = 709 Score = 62.0 bits (149), Expect = 1e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLRL 105 P+V+EEM++SGC PDRKARAMLRSALKYMK TL L Sbjct: 675 PSVYEEMILSGCTPDRKARAMLRSALKYMKQTLEL 709 >ref|XP_012437179.1| PREDICTED: ACT domain-containing protein ACR8-like [Gossypium raimondii] gi|823206810|ref|XP_012437180.1| PREDICTED: ACT domain-containing protein ACR8-like [Gossypium raimondii] gi|823206813|ref|XP_012437182.1| PREDICTED: ACT domain-containing protein ACR8-like [Gossypium raimondii] Length = 96 Score = 58.2 bits (139), Expect = 1e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLR 102 PAV+EEM++SGC PDRKARAMLRSAL+YMK ++ Sbjct: 44 PAVYEEMILSGCTPDRKARAMLRSALRYMKQAVK 77 >ref|XP_006435342.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|567885569|ref|XP_006435343.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|557537464|gb|ESR48582.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|557537465|gb|ESR48583.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] Length = 704 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLR 102 PAV+EEM++SGC PDRKARAMLRSAL+YMK TL+ Sbjct: 670 PAVYEEMILSGCTPDRKARAMLRSALRYMKQTLK 703 >ref|XP_002510663.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Ricinus communis] gi|223551364|gb|EEF52850.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 695 Score = 60.8 bits (146), Expect = 3e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 1 PAVFEEMLVSGCAPDRKARAMLRSALKYMKSTLRL 105 P+V+EEM+++GC PDRKARAMLRSALKYMK TL L Sbjct: 661 PSVYEEMILAGCTPDRKARAMLRSALKYMKQTLNL 695