BLASTX nr result
ID: Rehmannia27_contig00009064
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00009064 (629 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077435.1| PREDICTED: trihelix transcription factor ASI... 65 4e-09 emb|CDP08330.1| unnamed protein product [Coffea canephora] 62 8e-08 ref|XP_009613624.1| PREDICTED: uncharacterized protein LOC104106... 61 1e-07 ref|XP_009789567.1| PREDICTED: uncharacterized protein LOC104237... 61 1e-07 ref|XP_010324674.1| PREDICTED: trihelix transcription factor ASI... 60 4e-07 ref|XP_015084064.1| PREDICTED: trihelix transcription factor ASI... 60 4e-07 ref|XP_006362480.1| PREDICTED: trihelix transcription factor ASI... 60 4e-07 gb|ALF46657.1| trihelix protein, partial [Chrysanthemum x morifo... 56 6e-06 >ref|XP_011077435.1| PREDICTED: trihelix transcription factor ASIL2-like [Sesamum indicum] Length = 414 Score = 65.5 bits (158), Expect = 4e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 535 DKVEKPPRRFPPPCWTQEETLVLIDAYRERW 627 D VEK PRRFPPPCWTQEETL LI+AYRERW Sbjct: 18 DTVEKAPRRFPPPCWTQEETLALIEAYRERW 48 >emb|CDP08330.1| unnamed protein product [Coffea canephora] Length = 443 Score = 61.6 bits (148), Expect = 8e-08 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +1 Query: 535 DKVEKPPRRFPPPCWTQEETLVLIDAYRERW 627 D KP R+FPPPCWTQEETL LIDAYRERW Sbjct: 14 DAAGKPARKFPPPCWTQEETLALIDAYRERW 44 >ref|XP_009613624.1| PREDICTED: uncharacterized protein LOC104106723 [Nicotiana tomentosiformis] Length = 379 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 3/31 (9%) Frame = +1 Query: 544 EKPP---RRFPPPCWTQEETLVLIDAYRERW 627 EKPP RRFPPPCWTQEETL LIDAYRERW Sbjct: 19 EKPPPPARRFPPPCWTQEETLALIDAYRERW 49 >ref|XP_009789567.1| PREDICTED: uncharacterized protein LOC104237169 [Nicotiana sylvestris] Length = 382 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 3/31 (9%) Frame = +1 Query: 544 EKPP---RRFPPPCWTQEETLVLIDAYRERW 627 EKPP RRFPPPCWTQEETL LIDAYRERW Sbjct: 20 EKPPAPVRRFPPPCWTQEETLALIDAYRERW 50 >ref|XP_010324674.1| PREDICTED: trihelix transcription factor ASIL2-like [Solanum lycopersicum] Length = 408 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/31 (83%), Positives = 27/31 (87%), Gaps = 3/31 (9%) Frame = +1 Query: 544 EKPP---RRFPPPCWTQEETLVLIDAYRERW 627 EKPP RRFPPPCWTQEETL LI+AYRERW Sbjct: 19 EKPPPPVRRFPPPCWTQEETLALIEAYRERW 49 >ref|XP_015084064.1| PREDICTED: trihelix transcription factor ASIL2-like [Solanum pennellii] Length = 413 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/31 (83%), Positives = 27/31 (87%), Gaps = 3/31 (9%) Frame = +1 Query: 544 EKPP---RRFPPPCWTQEETLVLIDAYRERW 627 EKPP RRFPPPCWTQEETL LI+AYRERW Sbjct: 19 EKPPPPVRRFPPPCWTQEETLALIEAYRERW 49 >ref|XP_006362480.1| PREDICTED: trihelix transcription factor ASIL2-like [Solanum tuberosum] Length = 414 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/31 (83%), Positives = 27/31 (87%), Gaps = 3/31 (9%) Frame = +1 Query: 544 EKPP---RRFPPPCWTQEETLVLIDAYRERW 627 EKPP RRFPPPCWTQEETL LI+AYRERW Sbjct: 19 EKPPPPARRFPPPCWTQEETLALIEAYRERW 49 >gb|ALF46657.1| trihelix protein, partial [Chrysanthemum x morifolium] Length = 314 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +1 Query: 547 KPPRRFPPPCWTQEETLVLIDAYRERW 627 KP R+FPPPCWT++E LVLI+AYRERW Sbjct: 9 KPTRKFPPPCWTRDEALVLIEAYRERW 35