BLASTX nr result
ID: Rehmannia27_contig00008380
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00008380 (495 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015389714.1| PREDICTED: O-methyltransferase MdmC-like iso... 64 3e-09 ref|XP_015389713.1| PREDICTED: tricin synthase 1-like isoform X2... 64 3e-09 ref|XP_015389712.1| PREDICTED: tricin synthase 1-like isoform X1... 64 3e-09 dbj|BAT82389.1| hypothetical protein VIGAN_03240000 [Vigna angul... 60 4e-09 ref|XP_010091132.1| Tricin synthase 1 [Morus notabilis] gi|58785... 59 2e-07 gb|KRH43856.1| hypothetical protein GLYMA_08G175700 [Glycine max] 57 5e-07 ref|XP_015888402.1| PREDICTED: tricin synthase 1-like isoform X2... 57 5e-07 ref|XP_007051356.1| S-adenosyl-L-methionine-dependent methyltran... 57 5e-07 ref|XP_013600637.1| PREDICTED: O-methyltransferase MdmC [Brassic... 57 6e-07 ref|XP_013464365.1| caffeoyl-CoA O-methyltransferase [Medicago t... 57 6e-07 ref|XP_013708353.1| PREDICTED: O-methyltransferase MdmC-like [Br... 57 6e-07 ref|XP_010468996.1| PREDICTED: tricin synthase 1-like [Camelina ... 57 6e-07 ref|XP_010512579.1| PREDICTED: tricin synthase 1 [Camelina sativa] 57 6e-07 ref|XP_009116871.1| PREDICTED: tricin synthase 1 [Brassica rapa]... 57 6e-07 emb|CDX76608.1| BnaC08g31940D [Brassica napus] 57 6e-07 emb|CDY11390.1| BnaA09g39560D [Brassica napus] 57 6e-07 ref|XP_010063882.1| PREDICTED: tricin synthase 1-like [Eucalyptu... 57 6e-07 ref|XP_013464364.1| caffeoyl-CoA O-methyltransferase [Medicago t... 57 7e-07 ref|XP_015888401.1| PREDICTED: O-methyltransferase MdmC-like iso... 57 7e-07 ref|XP_014500426.1| PREDICTED: O-methyltransferase MdmC-like iso... 57 7e-07 >ref|XP_015389714.1| PREDICTED: O-methyltransferase MdmC-like isoform X3 [Citrus sinensis] Length = 290 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYTVCIS 98 VSPDQAQLLAMLVQILGA+RCIEVGVYTVC+S Sbjct: 103 VSPDQAQLLAMLVQILGAQRCIEVGVYTVCVS 134 >ref|XP_015389713.1| PREDICTED: tricin synthase 1-like isoform X2 [Citrus sinensis] gi|641868008|gb|KDO86692.1| hypothetical protein CISIN_1g022597mg [Citrus sinensis] Length = 294 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYTVCIS 98 VSPDQAQLLAMLVQILGA+RCIEVGVYTVC+S Sbjct: 103 VSPDQAQLLAMLVQILGAQRCIEVGVYTVCVS 134 >ref|XP_015389712.1| PREDICTED: tricin synthase 1-like isoform X1 [Citrus sinensis] Length = 297 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYTVCIS 98 VSPDQAQLLAMLVQILGA+RCIEVGVYTVC+S Sbjct: 103 VSPDQAQLLAMLVQILGAQRCIEVGVYTVCVS 134 >dbj|BAT82389.1| hypothetical protein VIGAN_03240000 [Vigna angularis var. angularis] Length = 103 Score = 60.5 bits (145), Expect = 4e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYTVCIS*FVYL 113 VS DQAQL AMLVQILG ERCIEVGVYTVC S F++L Sbjct: 36 VSSDQAQLFAMLVQILGEERCIEVGVYTVCPSFFIHL 72 >ref|XP_010091132.1| Tricin synthase 1 [Morus notabilis] gi|587852440|gb|EXB42567.1| Tricin synthase 1 [Morus notabilis] Length = 352 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYTVCI 95 VSPDQAQLLAMLVQILGAERCIEVGVYT+ I Sbjct: 112 VSPDQAQLLAMLVQILGAERCIEVGVYTIDI 142 >gb|KRH43856.1| hypothetical protein GLYMA_08G175700 [Glycine max] Length = 238 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIEVGVYT Sbjct: 135 VSPDQAQLLAMLVQILGAERCIEVGVYT 162 >ref|XP_015888402.1| PREDICTED: tricin synthase 1-like isoform X2 [Ziziphus jujuba] Length = 251 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIEVGVYT Sbjct: 130 VSPDQAQLLAMLVQILGAERCIEVGVYT 157 >ref|XP_007051356.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily protein isoform 2 [Theobroma cacao] gi|508703617|gb|EOX95513.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily protein isoform 2 [Theobroma cacao] Length = 218 Score = 57.0 bits (136), Expect = 5e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIE+GVYT Sbjct: 109 VSPDQAQLLAMLVQILGAERCIEIGVYT 136 >ref|XP_013600637.1| PREDICTED: O-methyltransferase MdmC [Brassica oleracea var. oleracea] Length = 272 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIEVGVYT Sbjct: 96 VSPDQAQLLAMLVQILGAERCIEVGVYT 123 >ref|XP_013464365.1| caffeoyl-CoA O-methyltransferase [Medicago truncatula] gi|657398879|gb|KEH38400.1| caffeoyl-CoA O-methyltransferase [Medicago truncatula] Length = 273 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIEVGVYT Sbjct: 122 VSPDQAQLLAMLVQILGAERCIEVGVYT 149 >ref|XP_013708353.1| PREDICTED: O-methyltransferase MdmC-like [Brassica napus] Length = 278 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIEVGVYT Sbjct: 102 VSPDQAQLLAMLVQILGAERCIEVGVYT 129 >ref|XP_010468996.1| PREDICTED: tricin synthase 1-like [Camelina sativa] Length = 278 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIEVGVYT Sbjct: 102 VSPDQAQLLAMLVQILGAERCIEVGVYT 129 >ref|XP_010512579.1| PREDICTED: tricin synthase 1 [Camelina sativa] Length = 278 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIEVGVYT Sbjct: 102 VSPDQAQLLAMLVQILGAERCIEVGVYT 129 >ref|XP_009116871.1| PREDICTED: tricin synthase 1 [Brassica rapa] gi|923716404|ref|XP_013663927.1| PREDICTED: O-methyltransferase MdmC-like [Brassica napus] Length = 278 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIEVGVYT Sbjct: 102 VSPDQAQLLAMLVQILGAERCIEVGVYT 129 >emb|CDX76608.1| BnaC08g31940D [Brassica napus] Length = 278 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIEVGVYT Sbjct: 102 VSPDQAQLLAMLVQILGAERCIEVGVYT 129 >emb|CDY11390.1| BnaA09g39560D [Brassica napus] Length = 278 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIEVGVYT Sbjct: 102 VSPDQAQLLAMLVQILGAERCIEVGVYT 129 >ref|XP_010063882.1| PREDICTED: tricin synthase 1-like [Eucalyptus grandis] gi|702382539|ref|XP_010063883.1| PREDICTED: tricin synthase 1-like [Eucalyptus grandis] gi|702382544|ref|XP_010063884.1| PREDICTED: tricin synthase 1-like [Eucalyptus grandis] gi|629105695|gb|KCW71164.1| hypothetical protein EUGRSUZ_F04260 [Eucalyptus grandis] gi|629105696|gb|KCW71165.1| hypothetical protein EUGRSUZ_F04260 [Eucalyptus grandis] gi|629105697|gb|KCW71166.1| hypothetical protein EUGRSUZ_F04260 [Eucalyptus grandis] gi|629105698|gb|KCW71167.1| hypothetical protein EUGRSUZ_F04260 [Eucalyptus grandis] Length = 289 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIEVGVYT Sbjct: 113 VSPDQAQLLAMLVQILGAERCIEVGVYT 140 >ref|XP_013464364.1| caffeoyl-CoA O-methyltransferase [Medicago truncatula] gi|657398878|gb|KEH38399.1| caffeoyl-CoA O-methyltransferase [Medicago truncatula] Length = 298 Score = 57.4 bits (137), Expect = 7e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIEVGVYT Sbjct: 122 VSPDQAQLLAMLVQILGAERCIEVGVYT 149 >ref|XP_015888401.1| PREDICTED: O-methyltransferase MdmC-like isoform X1 [Ziziphus jujuba] Length = 306 Score = 57.4 bits (137), Expect = 7e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIEVGVYT Sbjct: 130 VSPDQAQLLAMLVQILGAERCIEVGVYT 157 >ref|XP_014500426.1| PREDICTED: O-methyltransferase MdmC-like isoform X1 [Vigna radiata var. radiata] Length = 311 Score = 57.4 bits (137), Expect = 7e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 VSPDQAQLLAMLVQILGAERCIEVGVYT 86 VSPDQAQLLAMLVQILGAERCIEVGVYT Sbjct: 135 VSPDQAQLLAMLVQILGAERCIEVGVYT 162