BLASTX nr result
ID: Rehmannia27_contig00008234
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00008234 (466 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43177.1| hypothetical protein MIMGU_mgv1a016964mg [Erythra... 69 1e-12 >gb|EYU43177.1| hypothetical protein MIMGU_mgv1a016964mg [Erythranthe guttata] Length = 99 Score = 68.9 bits (167), Expect = 1e-12 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 407 QNGLPALISHKNQTLTVTPWWRVGLVSRLFNQG 309 ++GLP+LISHKNQTLTVTPWWRVGLVSRLFNQG Sbjct: 67 KSGLPSLISHKNQTLTVTPWWRVGLVSRLFNQG 99