BLASTX nr result
ID: Rehmannia27_contig00008055
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00008055 (439 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012854971.1| PREDICTED: uncharacterized protein LOC105974... 56 1e-06 >ref|XP_012854971.1| PREDICTED: uncharacterized protein LOC105974414 [Erythranthe guttata] gi|604346156|gb|EYU44653.1| hypothetical protein MIMGU_mgv1a011155mg [Erythranthe guttata] Length = 290 Score = 55.8 bits (133), Expect = 1e-06 Identities = 42/97 (43%), Positives = 50/97 (51%), Gaps = 4/97 (4%) Frame = -1 Query: 316 IIHRFPGFSASG---LLSLKRLPLASSRALGPNLTSVFPANNQGPFLSRAQIKHSSPK-P 149 ++ R P SASG +LSLKR LAS + PN + F N P L +K+ K Sbjct: 12 LVLRSPFSSASGCTCILSLKRHSLASLGSRRPNSCTNFAPNRHAPCLPITHLKNRIHKLS 71 Query: 148 RLVRGXXXXXXXXXXXXXXADKPTVPDNEFTLAKVSF 38 RLV ADKPTVPDNEF+LAKVSF Sbjct: 72 RLVPRAAESTQPSSIAATSADKPTVPDNEFSLAKVSF 108