BLASTX nr result
ID: Rehmannia27_contig00007802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00007802 (1087 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007024669.1| Small nuclear ribonucleoprotein family prote... 53 1e-12 gb|KVI05858.1| Like-Sm (LSM) domain-containing protein [Cynara c... 52 8e-11 ref|XP_011079585.1| PREDICTED: probable U6 snRNA-associated Sm-l... 60 9e-08 gb|EPS67133.1| hypothetical protein M569_07641 [Genlisea aurea] 60 9e-08 ref|XP_006598838.1| PREDICTED: sm-like protein LSM1B [Glycine ma... 57 4e-07 ref|XP_012831319.1| PREDICTED: sm-like protein LSM1B [Erythranth... 58 5e-07 ref|XP_014516656.1| PREDICTED: sm-like protein LSM1B isoform X2 ... 57 6e-07 ref|XP_014516657.1| PREDICTED: sm-like protein LSM1B [Vigna radi... 57 8e-07 ref|XP_011072603.1| PREDICTED: probable U6 snRNA-associated Sm-l... 57 8e-07 ref|XP_008380788.1| PREDICTED: probable U6 snRNA-associated Sm-l... 57 8e-07 ref|XP_007135420.1| hypothetical protein PHAVU_010G127900g [Phas... 57 8e-07 ref|XP_004303709.1| PREDICTED: sm-like protein LSM1B [Fragaria v... 57 8e-07 ref|NP_001237465.1| uncharacterized protein LOC100306352 [Glycin... 57 8e-07 ref|XP_010033722.1| PREDICTED: probable U6 snRNA-associated Sm-l... 57 1e-06 gb|KYP50472.1| U6 snRNA-associated Sm-like protein LSm1 [Cajanus... 57 2e-06 ref|XP_012856715.1| PREDICTED: sm-like protein LSM1B [Erythranth... 57 2e-06 ref|XP_002271476.1| PREDICTED: U6 snRNA-associated Sm-like prote... 56 2e-06 dbj|BAT98277.1| hypothetical protein VIGAN_09192000 [Vigna angul... 56 3e-06 dbj|BAT98276.1| hypothetical protein VIGAN_09191900 [Vigna angul... 56 3e-06 gb|KDO64963.1| hypothetical protein CISIN_1g0321082mg [Citrus si... 55 3e-06 >ref|XP_007024669.1| Small nuclear ribonucleoprotein family protein isoform 2 [Theobroma cacao] gi|508780035|gb|EOY27291.1| Small nuclear ribonucleoprotein family protein isoform 2 [Theobroma cacao] Length = 110 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 444 AEIKRAQKAEREASELKGTMKKRMDFLDMD 355 AEI+RAQKAEREA +LKGTM+KRM+FLD+D Sbjct: 81 AEIRRAQKAEREARDLKGTMRKRMEFLDLD 110 Score = 48.5 bits (114), Expect(2) = 1e-12 Identities = 27/45 (60%), Positives = 28/45 (62%) Frame = -3 Query: 629 WAGPEDIYLSTSLASYXXXXXXXXXXXXXXXXGTLRSFDQFANAV 495 + GPEDIYLSTSLASY GTLRSFDQFANAV Sbjct: 3 YLGPEDIYLSTSLASYLDKKLLVLLRDGRKLMGTLRSFDQFANAV 47 >gb|KVI05858.1| Like-Sm (LSM) domain-containing protein [Cynara cardunculus var. scolymus] Length = 107 Score = 51.6 bits (122), Expect(2) = 8e-11 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = -3 Query: 629 WAGPEDIYLSTSLASYXXXXXXXXXXXXXXXXGTLRSFDQFANAV 495 WAGPEDIYLSTSLASY G LRSFDQFANAV Sbjct: 3 WAGPEDIYLSTSLASYLDKKLLVLLRDGRKLLGILRSFDQFANAV 47 Score = 44.3 bits (103), Expect(2) = 8e-11 Identities = 19/25 (76%), Positives = 24/25 (96%) Frame = -2 Query: 429 AQKAEREASELKGTMKKRMDFLDMD 355 AQK EREA++LKG+M+KRM+FLDMD Sbjct: 83 AQKVEREATDLKGSMRKRMEFLDMD 107 >ref|XP_011079585.1| PREDICTED: probable U6 snRNA-associated Sm-like protein LSm1 [Sesamum indicum] Length = 128 Score = 60.1 bits (144), Expect = 9e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 444 AEIKRAQKAEREASELKGTMKKRMDFLDMD 355 AEI+RAQKAEREASELKGTMKKRMDFLDMD Sbjct: 99 AEIRRAQKAEREASELKGTMKKRMDFLDMD 128 >gb|EPS67133.1| hypothetical protein M569_07641 [Genlisea aurea] Length = 128 Score = 60.1 bits (144), Expect = 9e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 444 AEIKRAQKAEREASELKGTMKKRMDFLDMD 355 AEI+RAQKAEREASELKGTMKKRMDFLDMD Sbjct: 99 AEIRRAQKAEREASELKGTMKKRMDFLDMD 128 >ref|XP_006598838.1| PREDICTED: sm-like protein LSM1B [Glycine max] gi|947056805|gb|KRH06211.1| hypothetical protein GLYMA_16G009500 [Glycine max] Length = 95 Score = 57.4 bits (137), Expect = 4e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 447 TAEIKRAQKAEREASELKGTMKKRMDFLDMD 355 TAEIKRAQKAEREAS+LKGTM+KRM+FLD D Sbjct: 65 TAEIKRAQKAEREASDLKGTMRKRMEFLDFD 95 >ref|XP_012831319.1| PREDICTED: sm-like protein LSM1B [Erythranthe guttata] gi|604347738|gb|EYU45893.1| hypothetical protein MIMGU_mgv1a016267mg [Erythranthe guttata] Length = 128 Score = 58.2 bits (139), Expect = 5e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 447 TAEIKRAQKAEREASELKGTMKKRMDFLDMD 355 T EIKRAQKAEREASELKGTM KRMDFLDMD Sbjct: 98 TEEIKRAQKAEREASELKGTMIKRMDFLDMD 128 >ref|XP_014516656.1| PREDICTED: sm-like protein LSM1B isoform X2 [Vigna radiata var. radiata] Length = 116 Score = 57.4 bits (137), Expect = 6e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 447 TAEIKRAQKAEREASELKGTMKKRMDFLDMD 355 TAEIKRAQKAEREAS+LKGTM+KRM+FLD D Sbjct: 86 TAEIKRAQKAEREASDLKGTMRKRMEFLDFD 116 >ref|XP_014516657.1| PREDICTED: sm-like protein LSM1B [Vigna radiata var. radiata] Length = 128 Score = 57.4 bits (137), Expect = 8e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 447 TAEIKRAQKAEREASELKGTMKKRMDFLDMD 355 TAEIKRAQKAEREAS+LKGTM+KRM+FLD D Sbjct: 98 TAEIKRAQKAEREASDLKGTMRKRMEFLDFD 128 >ref|XP_011072603.1| PREDICTED: probable U6 snRNA-associated Sm-like protein LSm1 [Sesamum indicum] Length = 128 Score = 57.4 bits (137), Expect = 8e-07 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 447 TAEIKRAQKAEREASELKGTMKKRMDFLDMD 355 TA+I++AQKA+REASELKGTMK+RMDFLDMD Sbjct: 98 TADIRKAQKADREASELKGTMKRRMDFLDMD 128 >ref|XP_008380788.1| PREDICTED: probable U6 snRNA-associated Sm-like protein LSm1 [Malus domestica] gi|658013046|ref|XP_008341819.1| PREDICTED: probable U6 snRNA-associated Sm-like protein LSm1 [Malus domestica] gi|694451285|ref|XP_009350857.1| PREDICTED: probable U6 snRNA-associated Sm-like protein LSm1 [Pyrus x bretschneideri] Length = 128 Score = 57.4 bits (137), Expect = 8e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 444 AEIKRAQKAEREASELKGTMKKRMDFLDMD 355 AEIKRAQKAEREAS+LKGTM+KRM+FLDMD Sbjct: 99 AEIKRAQKAEREASDLKGTMRKRMEFLDMD 128 >ref|XP_007135420.1| hypothetical protein PHAVU_010G127900g [Phaseolus vulgaris] gi|561008465|gb|ESW07414.1| hypothetical protein PHAVU_010G127900g [Phaseolus vulgaris] Length = 128 Score = 57.4 bits (137), Expect = 8e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 447 TAEIKRAQKAEREASELKGTMKKRMDFLDMD 355 TAEIKRAQKAEREAS+LKGTM+KRM+FLD D Sbjct: 98 TAEIKRAQKAEREASDLKGTMRKRMEFLDFD 128 >ref|XP_004303709.1| PREDICTED: sm-like protein LSM1B [Fragaria vesca subsp. vesca] Length = 128 Score = 57.4 bits (137), Expect = 8e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 444 AEIKRAQKAEREASELKGTMKKRMDFLDMD 355 AEIKRAQKAEREAS+LKGTM+KRM+FLDMD Sbjct: 99 AEIKRAQKAEREASDLKGTMRKRMEFLDMD 128 >ref|NP_001237465.1| uncharacterized protein LOC100306352 [Glycine max] gi|593266482|ref|XP_007135419.1| hypothetical protein PHAVU_010G127800g [Phaseolus vulgaris] gi|951036571|ref|XP_014516654.1| PREDICTED: sm-like protein LSM1B isoform X1 [Vigna radiata var. radiata] gi|255628281|gb|ACU14485.1| unknown [Glycine max] gi|561008464|gb|ESW07413.1| hypothetical protein PHAVU_010G127800g [Phaseolus vulgaris] gi|734313531|gb|KHN01428.1| U6 snRNA-associated Sm-like protein LSm1 [Glycine soja] gi|734418459|gb|KHN39613.1| U6 snRNA-associated Sm-like protein LSm1 [Glycine soja] gi|947099143|gb|KRH47635.1| hypothetical protein GLYMA_07G040900 [Glycine max] Length = 128 Score = 57.4 bits (137), Expect = 8e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 447 TAEIKRAQKAEREASELKGTMKKRMDFLDMD 355 TAEIKRAQKAEREAS+LKGTM+KRM+FLD D Sbjct: 98 TAEIKRAQKAEREASDLKGTMRKRMEFLDFD 128 >ref|XP_010033722.1| PREDICTED: probable U6 snRNA-associated Sm-like protein LSm1 [Eucalyptus grandis] gi|629087164|gb|KCW53521.1| hypothetical protein EUGRSUZ_J02801 [Eucalyptus grandis] Length = 128 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 447 TAEIKRAQKAEREASELKGTMKKRMDFLDMD 355 TAEI+RAQKAEREAS+LKGTM+KRM+FLD+D Sbjct: 98 TAEIRRAQKAEREASDLKGTMRKRMEFLDLD 128 >gb|KYP50472.1| U6 snRNA-associated Sm-like protein LSm1 [Cajanus cajan] Length = 128 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 447 TAEIKRAQKAEREASELKGTMKKRMDFLDMD 355 TAEIKRAQKAEREAS+LKGTM+KRM+FLD++ Sbjct: 98 TAEIKRAQKAEREASDLKGTMRKRMEFLDLE 128 >ref|XP_012856715.1| PREDICTED: sm-like protein LSM1B [Erythranthe guttata] gi|604301718|gb|EYU21304.1| hypothetical protein MIMGU_mgv1a016277mg [Erythranthe guttata] Length = 128 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 441 EIKRAQKAEREASELKGTMKKRMDFLDMD 355 EIKRAQKAEREASELKGTMKK MDFLDMD Sbjct: 100 EIKRAQKAEREASELKGTMKKWMDFLDMD 128 >ref|XP_002271476.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm1 [Vitis vinifera] gi|147803430|emb|CAN62239.1| hypothetical protein VITISV_033727 [Vitis vinifera] gi|297742980|emb|CBI35847.3| unnamed protein product [Vitis vinifera] Length = 128 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 444 AEIKRAQKAEREASELKGTMKKRMDFLDMD 355 AEIKRAQKAEREAS+LKGTM+KRM+FLD+D Sbjct: 99 AEIKRAQKAEREASDLKGTMRKRMEFLDLD 128 >dbj|BAT98277.1| hypothetical protein VIGAN_09192000 [Vigna angularis var. angularis] Length = 128 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 447 TAEIKRAQKAEREASELKGTMKKRMDFLDMD 355 TAEIKRAQKAEREAS+LKGTM+KRM+FLD + Sbjct: 98 TAEIKRAQKAEREASDLKGTMRKRMEFLDFE 128 >dbj|BAT98276.1| hypothetical protein VIGAN_09191900 [Vigna angularis var. angularis] Length = 128 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 447 TAEIKRAQKAEREASELKGTMKKRMDFLDMD 355 TAEIKRAQKAEREAS+LKGTM+KRM+FLD + Sbjct: 98 TAEIKRAQKAEREASDLKGTMRKRMEFLDFE 128 >gb|KDO64963.1| hypothetical protein CISIN_1g0321082mg [Citrus sinensis] Length = 95 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -2 Query: 444 AEIKRAQKAEREASELKGTMKKRMDFLDMD 355 AEIKRAQKAEREAS+LKG+M+KRM+FLD+D Sbjct: 66 AEIKRAQKAEREASDLKGSMRKRMEFLDLD 95