BLASTX nr result
ID: Rehmannia27_contig00006096
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00006096 (462 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009788901.1| PREDICTED: frataxin, mitochondrial isoform X... 85 4e-18 ref|XP_009608124.1| PREDICTED: frataxin, mitochondrial isoform X... 85 4e-18 ref|XP_011079038.1| PREDICTED: frataxin, mitochondrial [Sesamum ... 86 5e-18 ref|XP_009788900.1| PREDICTED: frataxin, mitochondrial isoform X... 85 9e-18 ref|XP_009608123.1| PREDICTED: frataxin, mitochondrial isoform X... 85 9e-18 ref|XP_012843782.1| PREDICTED: frataxin, mitochondrial [Erythran... 84 2e-17 ref|XP_015081049.1| PREDICTED: frataxin, mitochondrial [Solanum ... 84 2e-17 ref|XP_006360538.1| PREDICTED: frataxin, mitochondrial [Solanum ... 84 2e-17 ref|XP_004243423.1| PREDICTED: frataxin, mitochondrial isoform X... 84 2e-17 ref|XP_010323779.1| PREDICTED: uncharacterized protein LOC101265... 84 3e-17 ref|XP_010670540.1| PREDICTED: frataxin, mitochondrial-like [Bet... 82 2e-16 emb|CDP11870.1| unnamed protein product [Coffea canephora] 80 7e-16 gb|EPS65040.1| hypothetical protein M569_09738, partial [Genlise... 78 1e-15 ref|XP_015880995.1| PREDICTED: frataxin, mitochondrial-like [Ziz... 79 3e-15 ref|XP_015880932.1| PREDICTED: frataxin, mitochondrial-like [Ziz... 79 3e-15 gb|KMT12588.1| hypothetical protein BVRB_5g098290 isoform C [Bet... 77 6e-15 gb|KHF99641.1| Frataxin, mitochondrial -like protein [Gossypium ... 77 6e-15 gb|KMT12590.1| hypothetical protein BVRB_5g098290 isoform E [Bet... 77 6e-15 ref|XP_015939525.1| PREDICTED: frataxin, mitochondrial [Arachis ... 77 9e-15 ref|XP_010676216.1| PREDICTED: frataxin, mitochondrial-like isof... 77 1e-14 >ref|XP_009788901.1| PREDICTED: frataxin, mitochondrial isoform X2 [Nicotiana sylvestris] Length = 164 Score = 85.1 bits (209), Expect = 4e-18 Identities = 40/56 (71%), Positives = 45/56 (80%) Frame = +1 Query: 295 FCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 +C R GPAAIDYRS+LQEDEYHRLA++TIH LLEKLEEYGDSV+IDGF Sbjct: 68 YCSRSSPLPDATQGPAAIDYRSLLQEDEYHRLANATIHDLLEKLEEYGDSVDIDGF 123 >ref|XP_009608124.1| PREDICTED: frataxin, mitochondrial isoform X2 [Nicotiana tomentosiformis] Length = 165 Score = 85.1 bits (209), Expect = 4e-18 Identities = 40/56 (71%), Positives = 45/56 (80%) Frame = +1 Query: 295 FCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 +C R GPAAIDYRS+LQEDEYHRLA++TIH LLEKLEEYGDSV+IDGF Sbjct: 69 YCSRSSPLPDASQGPAAIDYRSLLQEDEYHRLANATIHDLLEKLEEYGDSVDIDGF 124 >ref|XP_011079038.1| PREDICTED: frataxin, mitochondrial [Sesamum indicum] Length = 190 Score = 85.5 bits (210), Expect = 5e-18 Identities = 42/57 (73%), Positives = 44/57 (77%) Frame = +1 Query: 292 IFCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 I CRR GPAAIDYRS LQEDEYH LA+STIH LLEKLEEYGDSVEIDG+ Sbjct: 55 ICCRRLSSLSEESHGPAAIDYRSTLQEDEYHMLANSTIHDLLEKLEEYGDSVEIDGY 111 >ref|XP_009788900.1| PREDICTED: frataxin, mitochondrial isoform X1 [Nicotiana sylvestris] Length = 202 Score = 85.1 bits (209), Expect = 9e-18 Identities = 40/56 (71%), Positives = 45/56 (80%) Frame = +1 Query: 295 FCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 +C R GPAAIDYRS+LQEDEYHRLA++TIH LLEKLEEYGDSV+IDGF Sbjct: 68 YCSRSSPLPDATQGPAAIDYRSLLQEDEYHRLANATIHDLLEKLEEYGDSVDIDGF 123 >ref|XP_009608123.1| PREDICTED: frataxin, mitochondrial isoform X1 [Nicotiana tomentosiformis] Length = 203 Score = 85.1 bits (209), Expect = 9e-18 Identities = 40/56 (71%), Positives = 45/56 (80%) Frame = +1 Query: 295 FCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 +C R GPAAIDYRS+LQEDEYHRLA++TIH LLEKLEEYGDSV+IDGF Sbjct: 69 YCSRSSPLPDASQGPAAIDYRSLLQEDEYHRLANATIHDLLEKLEEYGDSVDIDGF 124 >ref|XP_012843782.1| PREDICTED: frataxin, mitochondrial [Erythranthe guttata] gi|604347047|gb|EYU45351.1| hypothetical protein MIMGU_mgv1a014139mg [Erythranthe guttata] Length = 199 Score = 84.3 bits (207), Expect = 2e-17 Identities = 42/57 (73%), Positives = 45/57 (78%) Frame = +1 Query: 292 IFCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 IFCRR GPAAIDY S LQEDE++RLA+STIH LLEKLEEYGDSVEIDGF Sbjct: 64 IFCRRLSSLIGESHGPAAIDYSSRLQEDEFNRLANSTIHDLLEKLEEYGDSVEIDGF 120 >ref|XP_015081049.1| PREDICTED: frataxin, mitochondrial [Solanum pennellii] Length = 194 Score = 84.0 bits (206), Expect = 2e-17 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = +1 Query: 295 FCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 +C R GPAAIDYRS+LQEDEYHRLA++TIH LL+KLEEYGDSV+IDGF Sbjct: 60 YCSRSSPLQDASEGPAAIDYRSLLQEDEYHRLANATIHDLLDKLEEYGDSVDIDGF 115 >ref|XP_006360538.1| PREDICTED: frataxin, mitochondrial [Solanum tuberosum] Length = 194 Score = 84.0 bits (206), Expect = 2e-17 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = +1 Query: 295 FCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 +C R GPAAIDYRS+LQEDEYHRLA++TIH LL+KLEEYGDSV+IDGF Sbjct: 60 YCSRSSPLQDASEGPAAIDYRSLLQEDEYHRLANATIHDLLDKLEEYGDSVDIDGF 115 >ref|XP_004243423.1| PREDICTED: frataxin, mitochondrial isoform X2 [Solanum lycopersicum] Length = 194 Score = 84.0 bits (206), Expect = 2e-17 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = +1 Query: 295 FCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 +C R GPAAIDYRS+LQEDEYHRLA++TIH LL+KLEEYGDSV+IDGF Sbjct: 60 YCSRSSPLQDASEGPAAIDYRSLLQEDEYHRLANATIHDLLDKLEEYGDSVDIDGF 115 >ref|XP_010323779.1| PREDICTED: uncharacterized protein LOC101265146 isoform X1 [Solanum lycopersicum] Length = 204 Score = 84.0 bits (206), Expect = 3e-17 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = +1 Query: 295 FCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 +C R GPAAIDYRS+LQEDEYHRLA++TIH LL+KLEEYGDSV+IDGF Sbjct: 60 YCSRSSPLQDASEGPAAIDYRSLLQEDEYHRLANATIHDLLDKLEEYGDSVDIDGF 115 >ref|XP_010670540.1| PREDICTED: frataxin, mitochondrial-like [Beta vulgaris subsp. vulgaris] gi|870865964|gb|KMT16993.1| hypothetical protein BVRB_2g041980 [Beta vulgaris subsp. vulgaris] Length = 198 Score = 81.6 bits (200), Expect = 2e-16 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 337 PAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 PA IDYRSVLQEDE+HRLA STIHHLLEKLEEYGD+VEIDGF Sbjct: 78 PAPIDYRSVLQEDEFHRLADSTIHHLLEKLEEYGDTVEIDGF 119 >emb|CDP11870.1| unnamed protein product [Coffea canephora] Length = 198 Score = 80.1 bits (196), Expect = 7e-16 Identities = 38/56 (67%), Positives = 43/56 (76%) Frame = +1 Query: 295 FCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 FC R GPAAIDY S+LQEDEY +LA+STIH LLEKLEEYGDSV+IDG+ Sbjct: 64 FCSRSNSFIDKSQGPAAIDYHSMLQEDEYQKLANSTIHDLLEKLEEYGDSVDIDGY 119 >gb|EPS65040.1| hypothetical protein M569_09738, partial [Genlisea aurea] Length = 142 Score = 78.2 bits (191), Expect = 1e-15 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 337 PAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 P A DYRS+LQEDEYHRLA+STIH+L+EKLEEYGDSVEIDGF Sbjct: 28 PEARDYRSILQEDEYHRLANSTIHNLVEKLEEYGDSVEIDGF 69 >ref|XP_015880995.1| PREDICTED: frataxin, mitochondrial-like [Ziziphus jujuba] Length = 198 Score = 78.6 bits (192), Expect = 3e-15 Identities = 37/56 (66%), Positives = 42/56 (75%) Frame = +1 Query: 295 FCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 FC R GPAAIDYRS+LQEDE+H+LA STIH L EKLEEYGD+V+ DGF Sbjct: 64 FCSRPLNLDGESQGPAAIDYRSLLQEDEFHKLADSTIHDLQEKLEEYGDNVQADGF 119 >ref|XP_015880932.1| PREDICTED: frataxin, mitochondrial-like [Ziziphus jujuba] Length = 198 Score = 78.6 bits (192), Expect = 3e-15 Identities = 37/56 (66%), Positives = 42/56 (75%) Frame = +1 Query: 295 FCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 FC R GPAAIDYRS+LQEDE+H+LA STIH L EKLEEYGD+V+ DGF Sbjct: 64 FCSRPLNLDGESQGPAAIDYRSLLQEDEFHKLADSTIHDLQEKLEEYGDNVQADGF 119 >gb|KMT12588.1| hypothetical protein BVRB_5g098290 isoform C [Beta vulgaris subsp. vulgaris] Length = 172 Score = 77.0 bits (188), Expect = 6e-15 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 337 PAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 PA IDYRSVLQEDE+H+LA STIH LLEKLEEYGD+VEIDGF Sbjct: 55 PAPIDYRSVLQEDEFHQLADSTIHRLLEKLEEYGDTVEIDGF 96 >gb|KHF99641.1| Frataxin, mitochondrial -like protein [Gossypium arboreum] Length = 190 Score = 77.4 bits (189), Expect = 6e-15 Identities = 38/56 (67%), Positives = 41/56 (73%) Frame = +1 Query: 295 FCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 FC GPA IDYRSVL EDE+HRLA+STIH+L EKLEEYGD VEIDGF Sbjct: 56 FCSDPLNLPQDSQGPAPIDYRSVLPEDEFHRLANSTIHNLQEKLEEYGDIVEIDGF 111 >gb|KMT12590.1| hypothetical protein BVRB_5g098290 isoform E [Beta vulgaris subsp. vulgaris] Length = 175 Score = 77.0 bits (188), Expect = 6e-15 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 337 PAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 PA IDYRSVLQEDE+H+LA STIH LLEKLEEYGD+VEIDGF Sbjct: 55 PAPIDYRSVLQEDEFHQLADSTIHRLLEKLEEYGDTVEIDGF 96 >ref|XP_015939525.1| PREDICTED: frataxin, mitochondrial [Arachis duranensis] gi|1012235435|ref|XP_015939526.1| PREDICTED: frataxin, mitochondrial [Arachis duranensis] Length = 193 Score = 77.0 bits (188), Expect = 9e-15 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +1 Query: 295 FCRRXXXXXXXXXGPAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 FC R GPAAIDYRS+LQE E+H+LA STIH L EKLE+YGD VE+DGF Sbjct: 59 FCSRSSKLLDESQGPAAIDYRSLLQEGEFHKLADSTIHSLQEKLEDYGDDVEVDGF 114 >ref|XP_010676216.1| PREDICTED: frataxin, mitochondrial-like isoform X3 [Beta vulgaris subsp. vulgaris] Length = 196 Score = 77.0 bits (188), Expect = 1e-14 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 337 PAAIDYRSVLQEDEYHRLAHSTIHHLLEKLEEYGDSVEIDGF 462 PA IDYRSVLQEDE+H+LA STIH LLEKLEEYGD+VEIDGF Sbjct: 79 PAPIDYRSVLQEDEFHQLADSTIHRLLEKLEEYGDTVEIDGF 120