BLASTX nr result
ID: Rehmannia27_contig00005768
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00005768 (683 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099249.1| PREDICTED: uncharacterized protein LOC105177... 41 2e-06 ref|XP_012852802.1| PREDICTED: uncharacterized protein LOC105972... 40 6e-06 >ref|XP_011099249.1| PREDICTED: uncharacterized protein LOC105177709 [Sesamum indicum] Length = 157 Score = 40.8 bits (94), Expect(3) = 2e-06 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = +3 Query: 378 KALGRWRKEAEEIVKEGFEAADKGIVAA 461 K L + +EAEEIVKEGFE DKGIVAA Sbjct: 64 KGLRKAEQEAEEIVKEGFEVVDKGIVAA 91 Score = 32.3 bits (72), Expect(3) = 2e-06 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 4/43 (9%) Frame = +2 Query: 284 LPKRRQCXXXXXXXXXXXXMEMPSR----PLLGLRQGLGKVEK 400 LP RR C ME+P+R PL GLR+GL K E+ Sbjct: 29 LPTRRHCLLLFTATTALKAMEVPARAQDIPLFGLRKGLRKAEQ 71 Score = 25.8 bits (55), Expect(3) = 2e-06 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = +1 Query: 466 SEKGVEAAEKGID 504 +EKG+EAAEKGI+ Sbjct: 91 AEKGIEAAEKGIE 103 >ref|XP_012852802.1| PREDICTED: uncharacterized protein LOC105972393 [Erythranthe guttata] Length = 154 Score = 39.7 bits (91), Expect(3) = 6e-06 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = +3 Query: 384 LGRWRKEAEEIVKEGFEAADKGIVAA 461 L + ++AEEIVKEGF+AADKGIVAA Sbjct: 70 LRKAEEQAEEIVKEGFDAADKGIVAA 95 Score = 32.3 bits (72), Expect(3) = 6e-06 Identities = 19/43 (44%), Positives = 21/43 (48%), Gaps = 4/43 (9%) Frame = +2 Query: 284 LPKRRQCXXXXXXXXXXXXMEMPSR----PLLGLRQGLGKVEK 400 LP RRQC EMPSR PL GLR+ L K E+ Sbjct: 33 LPTRRQCLLLLTATTALTVSEMPSRAQDIPLFGLRRNLRKAEE 75 Score = 25.0 bits (53), Expect(3) = 6e-06 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 466 SEKGVEAAEKGIDFLDIKIHKEI*F 540 +EKG+EAAEKG+ + +I + F Sbjct: 95 AEKGIEAAEKGVVAAEEEIETAVRF 119