BLASTX nr result
ID: Rehmannia27_contig00005556
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00005556 (641 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012839049.1| PREDICTED: LETM1 and EF-hand domain-containi... 50 4e-09 gb|EYU36668.1| hypothetical protein MIMGU_mgv1a001786mg [Erythra... 50 4e-09 gb|KNA22102.1| hypothetical protein SOVF_036940 [Spinacia oleracea] 43 3e-06 >ref|XP_012839049.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Erythranthe guttata] Length = 760 Score = 49.7 bits (117), Expect(2) = 4e-09 Identities = 30/43 (69%), Positives = 32/43 (74%) Frame = -3 Query: 132 DGEVEPMKACV*AARDESEDGAEIFVYIMVSFALTDKVDAMLQ 4 DGEVE MKA AA DESEDGAE+ +VS AL DKVDAMLQ Sbjct: 632 DGEVEAMKAYK-AAHDESEDGAEVPERHVVSSALIDKVDAMLQ 673 Score = 38.5 bits (88), Expect(2) = 4e-09 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -2 Query: 211 REHKEFIWLDNEEIELFNRMVDKDGT 134 RE +EF+ L N+EI+L+N MVDKDGT Sbjct: 606 REREEFLRLVNKEIKLYNSMVDKDGT 631 >gb|EYU36668.1| hypothetical protein MIMGU_mgv1a001786mg [Erythranthe guttata] Length = 759 Score = 49.7 bits (117), Expect(2) = 4e-09 Identities = 30/43 (69%), Positives = 32/43 (74%) Frame = -3 Query: 132 DGEVEPMKACV*AARDESEDGAEIFVYIMVSFALTDKVDAMLQ 4 DGEVE MKA AA DESEDGAE+ +VS AL DKVDAMLQ Sbjct: 631 DGEVEAMKAYK-AAHDESEDGAEVPERHVVSSALIDKVDAMLQ 672 Score = 38.5 bits (88), Expect(2) = 4e-09 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -2 Query: 211 REHKEFIWLDNEEIELFNRMVDKDGT 134 RE +EF+ L N+EI+L+N MVDKDGT Sbjct: 605 REREEFLRLVNKEIKLYNSMVDKDGT 630 >gb|KNA22102.1| hypothetical protein SOVF_036940 [Spinacia oleracea] Length = 727 Score = 42.7 bits (99), Expect(2) = 3e-06 Identities = 25/44 (56%), Positives = 31/44 (70%) Frame = -3 Query: 132 DGEVEPMKACV*AARDESEDGAEIFVYIMVSFALTDKVDAMLQK 1 DGE + +KA AAR+ES+ AE+ V VS AL D+VDAMLQK Sbjct: 598 DGEADALKAYK-AAREESDHAAEVAVGDKVSSALIDRVDAMLQK 640 Score = 35.8 bits (81), Expect(2) = 3e-06 Identities = 15/26 (57%), Positives = 22/26 (84%) Frame = -2 Query: 211 REHKEFIWLDNEEIELFNRMVDKDGT 134 RE +EF+ L N+EI+L+N MV+K+GT Sbjct: 572 REREEFLRLVNKEIDLYNTMVEKEGT 597