BLASTX nr result
ID: Rehmannia27_contig00004616
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00004616 (474 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097062.1| PREDICTED: UDP-glucuronate:xylan alpha-glucu... 61 4e-08 ref|XP_011097058.1| PREDICTED: UDP-glucuronate:xylan alpha-glucu... 61 4e-08 >ref|XP_011097062.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 1-like isoform X2 [Sesamum indicum] Length = 621 Score = 61.2 bits (147), Expect = 4e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 1 KNSRCKFHPLKLVLVIIVLATFLTILSSRTVCQQSSIS 114 K+SRCKFHPLKLVLVIIVL +FL I SS TVC Q+SIS Sbjct: 34 KSSRCKFHPLKLVLVIIVLGSFLMIFSSPTVCHQNSIS 71 >ref|XP_011097058.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 1-like isoform X1 [Sesamum indicum] gi|747098130|ref|XP_011097059.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 1-like isoform X1 [Sesamum indicum] gi|747098132|ref|XP_011097060.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 1-like isoform X1 [Sesamum indicum] gi|747098134|ref|XP_011097061.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 1-like isoform X1 [Sesamum indicum] Length = 627 Score = 61.2 bits (147), Expect = 4e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 1 KNSRCKFHPLKLVLVIIVLATFLTILSSRTVCQQSSIS 114 K+SRCKFHPLKLVLVIIVL +FL I SS TVC Q+SIS Sbjct: 34 KSSRCKFHPLKLVLVIIVLGSFLMIFSSPTVCHQNSIS 71