BLASTX nr result
ID: Rehmannia27_contig00003690
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00003690 (377 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847933.1| PREDICTED: reticulon-4-interacting protein 1... 56 1e-06 >ref|XP_012847933.1| PREDICTED: reticulon-4-interacting protein 1 homolog, mitochondrial [Erythranthe guttata] gi|604346540|gb|EYU44984.1| hypothetical protein MIMGU_mgv1a008391mg [Erythranthe guttata] Length = 375 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +2 Query: 263 GNGSSNPFAPFKVGFNKVQRTLVTSCRAVLLPRFGGPE 376 G GS F+ F+VGF++V+R++ TSCRAVLLPRFGGPE Sbjct: 15 GFGSRGSFSLFEVGFSEVRRSVATSCRAVLLPRFGGPE 52