BLASTX nr result
ID: Rehmannia27_contig00003600
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00003600 (372 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098577.1| PREDICTED: FACT complex subunit SSRP1 [Sesam... 79 8e-15 emb|CDP02200.1| unnamed protein product [Coffea canephora] 74 2e-13 ref|XP_012841387.1| PREDICTED: FACT complex subunit SSRP1 [Eryth... 72 3e-12 gb|EYU34110.1| hypothetical protein MIMGU_mgv1a002433mg [Erythra... 72 3e-12 ref|XP_015946008.1| PREDICTED: FACT complex subunit SSRP1 [Arach... 67 9e-11 ref|XP_011085774.1| PREDICTED: FACT complex subunit SSRP1-like i... 67 1e-10 ref|XP_011085773.1| PREDICTED: FACT complex subunit SSRP1-like i... 67 1e-10 ref|XP_010528322.1| PREDICTED: FACT complex subunit SSRP1 [Taren... 67 1e-10 ref|XP_007032454.1| High mobility group isoform 1 [Theobroma cac... 66 2e-10 gb|KVI09097.1| protein of unknown function DUF1747 [Cynara cardu... 66 3e-10 ref|XP_004499164.1| PREDICTED: FACT complex subunit SSRP1 [Cicer... 66 3e-10 sp|O04235.1|SSRP1_VICFA RecName: Full=FACT complex subunit SSRP1... 66 3e-10 ref|XP_007216981.1| hypothetical protein PRUPE_ppa002690mg [Prun... 66 3e-10 ref|XP_008357899.1| PREDICTED: FACT complex subunit SSRP1-like [... 63 4e-10 gb|KHN38820.1| FACT complex subunit SSRP1 [Glycine soja] 65 6e-10 gb|KRH65381.1| hypothetical protein GLYMA_03G031900 [Glycine max] 65 6e-10 ref|XP_014629569.1| PREDICTED: FACT complex subunit SSRP1-like [... 65 6e-10 ref|XP_002517473.1| PREDICTED: FACT complex subunit SSRP1 [Ricin... 65 8e-10 ref|XP_007151197.1| hypothetical protein PHAVU_004G026200g [Phas... 65 8e-10 ref|XP_008230730.1| PREDICTED: FACT complex subunit SSRP1 [Prunu... 64 1e-09 >ref|XP_011098577.1| PREDICTED: FACT complex subunit SSRP1 [Sesamum indicum] Length = 641 Score = 79.0 bits (193), Expect = 8e-15 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 MTAEEKAPYEAKARADKKRYT+EISGYKNPQ T VDSADESDS Sbjct: 598 MTAEEKAPYEAKARADKKRYTEEISGYKNPQTTN--VDSADESDS 640 >emb|CDP02200.1| unnamed protein product [Coffea canephora] Length = 317 Score = 74.3 bits (181), Expect = 2e-13 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 M+AEEKAPYEAKARADKKRY DEISGYKNPQA N +DS +ESD+ Sbjct: 273 MSAEEKAPYEAKARADKKRYNDEISGYKNPQAAVN-IDSGNESDT 316 >ref|XP_012841387.1| PREDICTED: FACT complex subunit SSRP1 [Erythranthe guttata] Length = 649 Score = 71.6 bits (174), Expect = 3e-12 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 MTA+EKAPYEAKA+ DKKRY +EISGYKNPQATTNL D+SDS Sbjct: 605 MTADEKAPYEAKAKVDKKRYAEEISGYKNPQATTNL-GLVDQSDS 648 >gb|EYU34110.1| hypothetical protein MIMGU_mgv1a002433mg [Erythranthe guttata] Length = 676 Score = 71.6 bits (174), Expect = 3e-12 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 MTA+EKAPYEAKA+ DKKRY +EISGYKNPQATTNL D+SDS Sbjct: 632 MTADEKAPYEAKAKVDKKRYAEEISGYKNPQATTNL-GLVDQSDS 675 >ref|XP_015946008.1| PREDICTED: FACT complex subunit SSRP1 [Arachis duranensis] Length = 641 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 M+AEEK PYEAKARADKKRY DEISGYKNPQ +DS +E+DS Sbjct: 598 MSAEEKEPYEAKARADKKRYKDEISGYKNPQPVN--IDSGNETDS 640 >ref|XP_011085774.1| PREDICTED: FACT complex subunit SSRP1-like isoform X2 [Sesamum indicum] gi|747077319|ref|XP_011085775.1| PREDICTED: FACT complex subunit SSRP1-like isoform X2 [Sesamum indicum] Length = 587 Score = 67.0 bits (162), Expect = 1e-10 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 MTA+EK+PYEAKARADKKRY++EISGYKNPQ T D+AD D+ Sbjct: 544 MTADEKSPYEAKARADKKRYSEEISGYKNPQTTN--ADTADAPDN 586 >ref|XP_011085773.1| PREDICTED: FACT complex subunit SSRP1-like isoform X1 [Sesamum indicum] Length = 639 Score = 67.0 bits (162), Expect = 1e-10 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 MTA+EK+PYEAKARADKKRY++EISGYKNPQ T D+AD D+ Sbjct: 596 MTADEKSPYEAKARADKKRYSEEISGYKNPQTTN--ADTADAPDN 638 >ref|XP_010528322.1| PREDICTED: FACT complex subunit SSRP1 [Tarenaya hassleriana] Length = 645 Score = 67.0 bits (162), Expect = 1e-10 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 M+AEE+ PYEAKARADKKRY DEISGYKNPQ N+ DS ++SDS Sbjct: 601 MSAEEREPYEAKARADKKRYKDEISGYKNPQ-PMNIDDSGNDSDS 644 >ref|XP_007032454.1| High mobility group isoform 1 [Theobroma cacao] gi|590649649|ref|XP_007032455.1| High mobility group isoform 1 [Theobroma cacao] gi|508711483|gb|EOY03380.1| High mobility group isoform 1 [Theobroma cacao] gi|508711484|gb|EOY03381.1| High mobility group isoform 1 [Theobroma cacao] Length = 640 Score = 66.2 bits (160), Expect = 2e-10 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 M+AEEK PYEAKARADK+RYTDE SGYKNPQ +DS +ESDS Sbjct: 597 MSAEEKEPYEAKARADKQRYTDEKSGYKNPQPMN--IDSGNESDS 639 >gb|KVI09097.1| protein of unknown function DUF1747 [Cynara cardunculus var. scolymus] Length = 635 Score = 65.9 bits (159), Expect = 3e-10 Identities = 32/44 (72%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQ-ATTNLVDSADES 130 ++AEEKAPYEA+A+ADKKRY EIS YKNPQ ATTNLVD +D + Sbjct: 592 LSAEEKAPYEARAQADKKRYQSEISDYKNPQPATTNLVDESDSN 635 >ref|XP_004499164.1| PREDICTED: FACT complex subunit SSRP1 [Cicer arietinum] Length = 641 Score = 65.9 bits (159), Expect = 3e-10 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 M+AEEK PYEAKA+ADKKRY DE+SGYKNPQ +DS +ESDS Sbjct: 598 MSAEEKEPYEAKAQADKKRYKDELSGYKNPQPMN--IDSGNESDS 640 >sp|O04235.1|SSRP1_VICFA RecName: Full=FACT complex subunit SSRP1; AltName: Full=Facilitates chromatin transcription complex subunit SSRP1; AltName: Full=Recombination signal sequence recognition protein 1 gi|2104679|emb|CAA66480.1| transcription factor [Vicia faba var. minor] Length = 642 Score = 65.9 bits (159), Expect = 3e-10 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 ++AEEK PYEAKA+ADKKRY DEISGYKNPQ VDS +ESDS Sbjct: 599 LSAEEKEPYEAKAQADKKRYKDEISGYKNPQPMN--VDSGNESDS 641 >ref|XP_007216981.1| hypothetical protein PRUPE_ppa002690mg [Prunus persica] gi|462413131|gb|EMJ18180.1| hypothetical protein PRUPE_ppa002690mg [Prunus persica] Length = 644 Score = 65.9 bits (159), Expect = 3e-10 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDSG 139 M+AEEK PYEAKAR DK RY DEISGYKNPQ +DS +ESDSG Sbjct: 601 MSAEEKEPYEAKARQDKLRYKDEISGYKNPQPMN--IDSGNESDSG 644 >ref|XP_008357899.1| PREDICTED: FACT complex subunit SSRP1-like [Malus domestica] Length = 167 Score = 63.2 bits (152), Expect = 4e-10 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESD 133 M+AEEK PYEAKAR DK+RY DEISGYKNPQ +DS +ESD Sbjct: 126 MSAEEKEPYEAKARQDKERYKDEISGYKNPQPMN--IDSGNESD 167 >gb|KHN38820.1| FACT complex subunit SSRP1 [Glycine soja] Length = 582 Score = 65.1 bits (157), Expect = 6e-10 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 ++AEEK PYEAKAR DKKRY DEISGYKNPQ +DS +ESDS Sbjct: 539 LSAEEKEPYEAKAREDKKRYMDEISGYKNPQPMN--IDSGNESDS 581 >gb|KRH65381.1| hypothetical protein GLYMA_03G031900 [Glycine max] Length = 606 Score = 65.1 bits (157), Expect = 6e-10 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 ++AEEK PYEAKAR DKKRY DEISGYKNPQ +DS +ESDS Sbjct: 563 LSAEEKEPYEAKAREDKKRYMDEISGYKNPQPMN--IDSGNESDS 605 >ref|XP_014629569.1| PREDICTED: FACT complex subunit SSRP1-like [Glycine max] Length = 613 Score = 65.1 bits (157), Expect = 6e-10 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 ++AEEK PYEAKAR DKKRY DEISGYKNPQ +DS +ESDS Sbjct: 570 LSAEEKEPYEAKAREDKKRYMDEISGYKNPQPMN--IDSGNESDS 612 >ref|XP_002517473.1| PREDICTED: FACT complex subunit SSRP1 [Ricinus communis] gi|223543484|gb|EEF45015.1| structure-specific recognition protein, putative [Ricinus communis] Length = 640 Score = 64.7 bits (156), Expect = 8e-10 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 ++AEEK PYEAKARADKKRY +E+SGYKNPQ +DS +ESDS Sbjct: 597 LSAEEKEPYEAKARADKKRYKEEVSGYKNPQPMD--IDSGNESDS 639 >ref|XP_007151197.1| hypothetical protein PHAVU_004G026200g [Phaseolus vulgaris] gi|561024506|gb|ESW23191.1| hypothetical protein PHAVU_004G026200g [Phaseolus vulgaris] Length = 640 Score = 64.7 bits (156), Expect = 8e-10 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDS 136 M+ EEK PYEAKAR DKKRY DEISGYKNPQ +DS +ESDS Sbjct: 597 MSVEEKEPYEAKAREDKKRYKDEISGYKNPQPMN--IDSGNESDS 639 >ref|XP_008230730.1| PREDICTED: FACT complex subunit SSRP1 [Prunus mume] Length = 644 Score = 64.3 bits (155), Expect = 1e-09 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = +2 Query: 2 MTAEEKAPYEAKARADKKRYTDEISGYKNPQATTNLVDSADESDSG 139 M+ EEK PYEAKAR DK RY DEISGYKNPQ +DS +ESDSG Sbjct: 601 MSVEEKEPYEAKARQDKLRYKDEISGYKNPQPMN--IDSGNESDSG 644