BLASTX nr result
ID: Rehmannia27_contig00003543
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00003543 (369 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA11674.1| unnamed protein product [Nicotiana tabacum] 58 2e-07 >dbj|BAA11674.1| unnamed protein product [Nicotiana tabacum] Length = 1338 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -1 Query: 369 TDENGADMLTKSLPRDKFKACKSKAGLVDFPHKVEGENC 253 TDENG+DMLTK+LP+ KF+ C+ AG+VD P+ +GENC Sbjct: 1300 TDENGSDMLTKTLPKGKFEFCREAAGIVDPPYSWKGENC 1338