BLASTX nr result
ID: Rehmannia27_contig00002882
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00002882 (360 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081281.1| PREDICTED: RNA-binding protein FUS isoform X... 123 1e-31 emb|CDP08361.1| unnamed protein product [Coffea canephora] 112 3e-27 ref|XP_011081284.1| PREDICTED: plasminogen activator inhibitor 1... 108 6e-26 ref|XP_012070071.1| PREDICTED: U3 small nucleolar RNA-associated... 103 3e-24 ref|XP_012858947.1| PREDICTED: plasminogen activator inhibitor 1... 103 6e-24 ref|XP_012858963.1| PREDICTED: plasminogen activator inhibitor 1... 102 7e-24 ref|XP_009594553.1| PREDICTED: plasminogen activator inhibitor 1... 102 1e-23 gb|KDO57093.1| hypothetical protein CISIN_1g017915mg [Citrus sin... 101 1e-23 gb|KDO57095.1| hypothetical protein CISIN_1g017915mg [Citrus sin... 101 2e-23 gb|KDO57096.1| hypothetical protein CISIN_1g017915mg [Citrus sin... 101 2e-23 ref|XP_006477112.1| PREDICTED: plasminogen activator inhibitor 1... 101 2e-23 ref|XP_006440205.1| hypothetical protein CICLE_v10020747mg [Citr... 101 2e-23 ref|XP_009766508.1| PREDICTED: plasminogen activator inhibitor 1... 100 8e-23 gb|KCW77831.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus g... 100 1e-22 ref|XP_009368155.1| PREDICTED: plasminogen activator inhibitor 1... 99 1e-22 ref|XP_009368154.1| PREDICTED: plasminogen activator inhibitor 1... 99 1e-22 ref|XP_008369209.1| PREDICTED: plasminogen activator inhibitor 1... 99 2e-22 emb|CAN75176.1| hypothetical protein VITISV_016687 [Vitis vinifera] 98 4e-22 ref|XP_002266051.1| PREDICTED: uncharacterized protein DDB_G0288... 98 4e-22 ref|XP_002531778.1| PREDICTED: plasminogen activator inhibitor 1... 97 7e-22 >ref|XP_011081281.1| PREDICTED: RNA-binding protein FUS isoform X1 [Sesamum indicum] Length = 365 Score = 123 bits (309), Expect = 1e-31 Identities = 62/81 (76%), Positives = 64/81 (79%), Gaps = 1/81 (1%) Frame = +2 Query: 2 YNNXXXXXXXXXXXXFDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNE-VKNV 178 YNN FDRRSGTGRG E KREGAGRGNWGTPTDEIVPETEEPTNE VKNV Sbjct: 149 YNNGEAAEGDRPRRAFDRRSGTGRGTEFKREGAGRGNWGTPTDEIVPETEEPTNEGVKNV 208 Query: 179 DSEKESGQDDVGDANKDSPAN 241 DSEK+SG+DDV DANKDS AN Sbjct: 209 DSEKQSGEDDVIDANKDSSAN 229 >emb|CDP08361.1| unnamed protein product [Coffea canephora] Length = 381 Score = 112 bits (279), Expect = 3e-27 Identities = 52/63 (82%), Positives = 56/63 (88%), Gaps = 1/63 (1%) Frame = +2 Query: 47 FDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNE-VKNVDSEKESGQDDVGDAN 223 FDRRSGTGRGNE+KREGAGRGNWGTPTDEI PETEEP NE KN D+EK+SGQ+ VGD N Sbjct: 178 FDRRSGTGRGNEIKREGAGRGNWGTPTDEIAPETEEPVNEGEKNADAEKQSGQETVGDGN 237 Query: 224 KDS 232 KDS Sbjct: 238 KDS 240 >ref|XP_011081284.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like [Sesamum indicum] Length = 358 Score = 108 bits (269), Expect = 6e-26 Identities = 53/65 (81%), Positives = 57/65 (87%), Gaps = 1/65 (1%) Frame = +2 Query: 47 FDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNE-VKNVDSEKESGQDDVGDAN 223 FDRRSGTGRG E KREGAGRGNWGT TDEIV +TEEP +E VKNV+SEK SGQDDVGDAN Sbjct: 157 FDRRSGTGRGTEYKREGAGRGNWGTHTDEIVQDTEEPDSEGVKNVESEKRSGQDDVGDAN 216 Query: 224 KDSPA 238 KD+ A Sbjct: 217 KDTSA 221 >ref|XP_012070071.1| PREDICTED: U3 small nucleolar RNA-associated protein 25 [Jatropha curcas] gi|643732942|gb|KDP39931.1| hypothetical protein JCGZ_03462 [Jatropha curcas] Length = 366 Score = 103 bits (258), Expect = 3e-24 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 1/66 (1%) Frame = +2 Query: 47 FDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNEV-KNVDSEKESGQDDVGDAN 223 ++RRSGTGRGNE+KR+GAGRGNWGTPTDEI ETEEP E+ KNV +EK SG++D DAN Sbjct: 162 YERRSGTGRGNEIKRDGAGRGNWGTPTDEIAQETEEPVTEIEKNVVAEKPSGEEDAADAN 221 Query: 224 KDSPAN 241 K+SPA+ Sbjct: 222 KESPAD 227 >ref|XP_012858947.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like [Erythranthe guttata] gi|604299596|gb|EYU19470.1| hypothetical protein MIMGU_mgv1a008507mg [Erythranthe guttata] Length = 371 Score = 103 bits (256), Expect = 6e-24 Identities = 47/63 (74%), Positives = 53/63 (84%) Frame = +2 Query: 47 FDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNEVKNVDSEKESGQDDVGDANK 226 +DR SGTGRGNE KREGAGRGNWGT T++I PETEEP +EVK VD EK SG++D DANK Sbjct: 168 YDRHSGTGRGNEFKREGAGRGNWGTHTEDIAPETEEPASEVKIVDPEKPSGEEDAVDANK 227 Query: 227 DSP 235 DSP Sbjct: 228 DSP 230 >ref|XP_012858963.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like [Erythranthe guttata] gi|604299593|gb|EYU19467.1| hypothetical protein MIMGU_mgv1a008831mg [Erythranthe guttata] gi|604299594|gb|EYU19468.1| hypothetical protein MIMGU_mgv1a008831mg [Erythranthe guttata] Length = 361 Score = 102 bits (255), Expect = 7e-24 Identities = 48/63 (76%), Positives = 54/63 (85%), Gaps = 1/63 (1%) Frame = +2 Query: 47 FDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNEVKNV-DSEKESGQDDVGDAN 223 F+RRSGTG GNE+KREG GRGNWGTP +EIVPE EEPT EVK V DSEK+SG+D+ DAN Sbjct: 151 FERRSGTGHGNEIKREGFGRGNWGTPNEEIVPEIEEPTTEVKKVIDSEKKSGEDETDDAN 210 Query: 224 KDS 232 KDS Sbjct: 211 KDS 213 >ref|XP_009594553.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like [Nicotiana tomentosiformis] Length = 365 Score = 102 bits (254), Expect = 1e-23 Identities = 50/78 (64%), Positives = 56/78 (71%), Gaps = 1/78 (1%) Frame = +2 Query: 2 YNNXXXXXXXXXXXXFDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNE-VKNV 178 +NN +DRRSGTGRGN+ KREGAGRGNWGTPTDEI PETEEP E K V Sbjct: 146 FNNEEGGEGDRPRRVYDRRSGTGRGNDFKREGAGRGNWGTPTDEIAPETEEPAAEGEKIV 205 Query: 179 DSEKESGQDDVGDANKDS 232 DSEK +G++D GDA KDS Sbjct: 206 DSEKPAGEEDAGDAKKDS 223 >gb|KDO57093.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis] Length = 335 Score = 101 bits (252), Expect = 1e-23 Identities = 43/65 (66%), Positives = 55/65 (84%) Frame = +2 Query: 47 FDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNEVKNVDSEKESGQDDVGDANK 226 F+RRSGTGRGNE+KR+GAGRGNWGTPTDEI ETEEP E +N ++EK SG+++ DANK Sbjct: 158 FERRSGTGRGNEIKRDGAGRGNWGTPTDEIAQETEEPVAETENTNAEKPSGEENAADANK 217 Query: 227 DSPAN 241 ++P + Sbjct: 218 ENPVD 222 >gb|KDO57095.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis] Length = 363 Score = 101 bits (252), Expect = 2e-23 Identities = 43/65 (66%), Positives = 55/65 (84%) Frame = +2 Query: 47 FDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNEVKNVDSEKESGQDDVGDANK 226 F+RRSGTGRGNE+KR+GAGRGNWGTPTDEI ETEEP E +N ++EK SG+++ DANK Sbjct: 158 FERRSGTGRGNEIKRDGAGRGNWGTPTDEIAQETEEPVAETENTNAEKPSGEENAADANK 217 Query: 227 DSPAN 241 ++P + Sbjct: 218 ENPVD 222 >gb|KDO57096.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis] Length = 364 Score = 101 bits (252), Expect = 2e-23 Identities = 43/65 (66%), Positives = 55/65 (84%) Frame = +2 Query: 47 FDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNEVKNVDSEKESGQDDVGDANK 226 F+RRSGTGRGNE+KR+GAGRGNWGTPTDEI ETEEP E +N ++EK SG+++ DANK Sbjct: 158 FERRSGTGRGNEIKRDGAGRGNWGTPTDEIAQETEEPVAETENTNAEKPSGEENAADANK 217 Query: 227 DSPAN 241 ++P + Sbjct: 218 ENPVD 222 >ref|XP_006477112.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein isoform X1 [Citrus sinensis] Length = 364 Score = 101 bits (252), Expect = 2e-23 Identities = 43/65 (66%), Positives = 55/65 (84%) Frame = +2 Query: 47 FDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNEVKNVDSEKESGQDDVGDANK 226 F+RRSGTGRGNE+KR+GAGRGNWGTPTDEI ETEEP E +N ++EK SG+++ DANK Sbjct: 158 FERRSGTGRGNEIKRDGAGRGNWGTPTDEIAQETEEPVAETENTNAEKPSGEENAADANK 217 Query: 227 DSPAN 241 ++P + Sbjct: 218 ENPVD 222 >ref|XP_006440205.1| hypothetical protein CICLE_v10020747mg [Citrus clementina] gi|557542467|gb|ESR53445.1| hypothetical protein CICLE_v10020747mg [Citrus clementina] Length = 364 Score = 101 bits (252), Expect = 2e-23 Identities = 43/65 (66%), Positives = 55/65 (84%) Frame = +2 Query: 47 FDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNEVKNVDSEKESGQDDVGDANK 226 F+RRSGTGRGNE+KR+GAGRGNWGTPTDEI ETEEP E +N ++EK SG+++ DANK Sbjct: 158 FERRSGTGRGNEIKRDGAGRGNWGTPTDEIAQETEEPVAETENTNAEKPSGEENAADANK 217 Query: 227 DSPAN 241 ++P + Sbjct: 218 ENPVD 222 >ref|XP_009766508.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like [Nicotiana sylvestris] Length = 369 Score = 100 bits (248), Expect = 8e-23 Identities = 49/80 (61%), Positives = 55/80 (68%), Gaps = 1/80 (1%) Frame = +2 Query: 2 YNNXXXXXXXXXXXXFDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNE-VKNV 178 +NN +DRRSGTGRGN+ KREGAGR NWGTPTDEI PETEEP E K V Sbjct: 147 FNNEEGAEGDRPRRVYDRRSGTGRGNDFKREGAGRANWGTPTDEIAPETEEPVTEGEKIV 206 Query: 179 DSEKESGQDDVGDANKDSPA 238 D EK +G++D GDA KDS A Sbjct: 207 DPEKPAGEEDAGDAKKDSSA 226 >gb|KCW77831.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis] Length = 369 Score = 99.8 bits (247), Expect = 1e-22 Identities = 49/81 (60%), Positives = 56/81 (69%), Gaps = 1/81 (1%) Frame = +2 Query: 2 YNNXXXXXXXXXXXXFDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNEV-KNV 178 YNN FDRRSGTGRGNE KR+GAGRGNWGTPTDEI PE EEP EV KNV Sbjct: 144 YNNEEAGEGERPRRAFDRRSGTGRGNEFKRDGAGRGNWGTPTDEIAPEPEEPVVEVEKNV 203 Query: 179 DSEKESGQDDVGDANKDSPAN 241 SEK+ ++ DA+K++P N Sbjct: 204 GSEKQLVDEEAADASKENPLN 224 >ref|XP_009368155.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like isoform X2 [Pyrus x bretschneideri] Length = 359 Score = 99.4 bits (246), Expect = 1e-22 Identities = 46/81 (56%), Positives = 57/81 (70%), Gaps = 1/81 (1%) Frame = +2 Query: 2 YNNXXXXXXXXXXXXFDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNEV-KNV 178 YNN FDRRSGTGRG++ KREG+GRGNWGTP+D+I PETEEP E KNV Sbjct: 140 YNNGEDGEGERPRRVFDRRSGTGRGSDFKREGSGRGNWGTPSDDIAPETEEPGTETEKNV 199 Query: 179 DSEKESGQDDVGDANKDSPAN 241 +EK+SG+++ DANK+ N Sbjct: 200 SAEKQSGENEAADANKEDAVN 220 >ref|XP_009368154.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like isoform X1 [Pyrus x bretschneideri] Length = 362 Score = 99.4 bits (246), Expect = 1e-22 Identities = 46/81 (56%), Positives = 57/81 (70%), Gaps = 1/81 (1%) Frame = +2 Query: 2 YNNXXXXXXXXXXXXFDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNEV-KNV 178 YNN FDRRSGTGRG++ KREG+GRGNWGTP+D+I PETEEP E KNV Sbjct: 140 YNNGEDGEGERPRRVFDRRSGTGRGSDFKREGSGRGNWGTPSDDIAPETEEPGTETEKNV 199 Query: 179 DSEKESGQDDVGDANKDSPAN 241 +EK+SG+++ DANK+ N Sbjct: 200 SAEKQSGENEAADANKEDAVN 220 >ref|XP_008369209.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein [Malus domestica] Length = 359 Score = 99.0 bits (245), Expect = 2e-22 Identities = 46/81 (56%), Positives = 57/81 (70%), Gaps = 1/81 (1%) Frame = +2 Query: 2 YNNXXXXXXXXXXXXFDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNEV-KNV 178 YNN FDRRSGTGRG++ KREG+GRGNWGTP+D+I PETEEP E KNV Sbjct: 137 YNNGEDGEGERPRRVFDRRSGTGRGSDFKREGSGRGNWGTPSDDIAPETEEPGTETEKNV 196 Query: 179 DSEKESGQDDVGDANKDSPAN 241 +EK+SG+++ DANK+ N Sbjct: 197 GAEKQSGENEAADANKEDTVN 217 >emb|CAN75176.1| hypothetical protein VITISV_016687 [Vitis vinifera] Length = 363 Score = 98.2 bits (243), Expect = 4e-22 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 1/66 (1%) Frame = +2 Query: 47 FDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNEV-KNVDSEKESGQDDVGDAN 223 ++RRSGTGRGNE+KR+GAGRGNWGTP DEI PE EEP NE KN +EK+ G++ DAN Sbjct: 160 YERRSGTGRGNEIKRDGAGRGNWGTPADEIAPENEEPINETEKNTSAEKQLGEEIAADAN 219 Query: 224 KDSPAN 241 K++P N Sbjct: 220 KENPVN 225 >ref|XP_002266051.1| PREDICTED: uncharacterized protein DDB_G0288133 [Vitis vinifera] gi|296085734|emb|CBI29539.3| unnamed protein product [Vitis vinifera] Length = 363 Score = 98.2 bits (243), Expect = 4e-22 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 1/66 (1%) Frame = +2 Query: 47 FDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNEV-KNVDSEKESGQDDVGDAN 223 ++RRSGTGRGNE+KR+GAGRGNWGTP DEI PE EEP NE KN +EK+ G++ DAN Sbjct: 160 YERRSGTGRGNEIKRDGAGRGNWGTPADEIAPENEEPINETEKNTSAEKQLGEEIAADAN 219 Query: 224 KDSPAN 241 K++P N Sbjct: 220 KENPVN 225 >ref|XP_002531778.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein [Ricinus communis] gi|223528571|gb|EEF30592.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative [Ricinus communis] Length = 364 Score = 97.4 bits (241), Expect = 7e-22 Identities = 46/66 (69%), Positives = 51/66 (77%), Gaps = 1/66 (1%) Frame = +2 Query: 47 FDRRSGTGRGNEVKREGAGRGNWGTPTDEIVPETEEPTNE-VKNVDSEKESGQDDVGDAN 223 +DRRSGTGRGNE KREGAGRGNWGTP DEI PE EEP E KN+ EK SG++ DAN Sbjct: 160 YDRRSGTGRGNEFKREGAGRGNWGTPADEIAPEIEEPLIENEKNIGIEKPSGEEGAADAN 219 Query: 224 KDSPAN 241 KD+P N Sbjct: 220 KDNPMN 225