BLASTX nr result
ID: Rehmannia27_contig00002576
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00002576 (476 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078593.1| PREDICTED: FIP1[V]-like protein isoform X2 [... 59 3e-07 ref|XP_011078592.1| PREDICTED: FIP1[V]-like protein isoform X1 [... 59 3e-07 ref|XP_012851839.1| PREDICTED: FIP1[V]-like protein [Erythranthe... 58 5e-07 >ref|XP_011078593.1| PREDICTED: FIP1[V]-like protein isoform X2 [Sesamum indicum] Length = 1396 Score = 58.9 bits (141), Expect = 3e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -2 Query: 421 KKMESEPMPLGQQTETRPDSEIKSERPARKRRWTGN 314 KKMESEP+P QTE R DSEIK ERPARKRRWTGN Sbjct: 1362 KKMESEPLP-PPQTENRTDSEIKPERPARKRRWTGN 1396 >ref|XP_011078592.1| PREDICTED: FIP1[V]-like protein isoform X1 [Sesamum indicum] Length = 1397 Score = 58.9 bits (141), Expect = 3e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -2 Query: 421 KKMESEPMPLGQQTETRPDSEIKSERPARKRRWTGN 314 KKMESEP+P QTE R DSEIK ERPARKRRWTGN Sbjct: 1363 KKMESEPLP-PPQTENRTDSEIKPERPARKRRWTGN 1397 >ref|XP_012851839.1| PREDICTED: FIP1[V]-like protein [Erythranthe guttata] gi|604306546|gb|EYU25349.1| hypothetical protein MIMGU_mgv1a000329mg [Erythranthe guttata] Length = 1251 Score = 58.2 bits (139), Expect = 5e-07 Identities = 32/45 (71%), Positives = 35/45 (77%), Gaps = 3/45 (6%) Frame = -2 Query: 439 LSSTTFKKMESEPMPLGQ--QTETRP-DSEIKSERPARKRRWTGN 314 +S+TT K +ESE P QTETRP DSEIKSERPARKRRWTGN Sbjct: 1207 VSTTTVKNIESEKQPTLPLVQTETRPTDSEIKSERPARKRRWTGN 1251