BLASTX nr result
ID: Rehmannia27_contig00002321
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00002321 (370 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS65250.1| hypothetical protein M569_09526, partial [Genlise... 55 3e-07 ref|XP_011097004.1| PREDICTED: 50S ribosomal protein L21, chloro... 55 8e-07 ref|XP_012854783.1| PREDICTED: 50S ribosomal protein L21, chloro... 55 8e-07 ref|XP_010256399.1| PREDICTED: 50S ribosomal protein L21, chloro... 54 3e-06 ref|XP_007019987.1| 50S ribosomal protein L21 isoform 2 [Theobro... 53 6e-06 emb|CDP08407.1| unnamed protein product [Coffea canephora] 53 6e-06 >gb|EPS65250.1| hypothetical protein M569_09526, partial [Genlisea aurea] Length = 140 Score = 55.1 bits (131), Expect = 3e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -1 Query: 334 IGHRQPITRIRVTSITGYQDSPAVTL 257 IGHRQPITRIR+TSITGYQDSPAVTL Sbjct: 114 IGHRQPITRIRITSITGYQDSPAVTL 139 >ref|XP_011097004.1| PREDICTED: 50S ribosomal protein L21, chloroplastic [Sesamum indicum] Length = 206 Score = 55.1 bits (131), Expect = 8e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -1 Query: 334 IGHRQPITRIRVTSITGYQDSPAVTL 257 IGHRQPITRIR+TSITGYQDSPAVTL Sbjct: 180 IGHRQPITRIRITSITGYQDSPAVTL 205 >ref|XP_012854783.1| PREDICTED: 50S ribosomal protein L21, chloroplastic [Erythranthe guttata] gi|604303370|gb|EYU22843.1| hypothetical protein MIMGU_mgv1a013916mg [Erythranthe guttata] Length = 206 Score = 55.1 bits (131), Expect = 8e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 334 IGHRQPITRIRVTSITGYQDSPAVTLP 254 IGHRQPITRI++TSITGYQDSP VTLP Sbjct: 180 IGHRQPITRIKITSITGYQDSPVVTLP 206 >ref|XP_010256399.1| PREDICTED: 50S ribosomal protein L21, chloroplastic [Nelumbo nucifera] Length = 219 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 334 IGHRQPITRIRVTSITGYQDSPAVTL 257 IGHRQPITRIR+T ITGYQDSPAVTL Sbjct: 192 IGHRQPITRIRITGITGYQDSPAVTL 217 >ref|XP_007019987.1| 50S ribosomal protein L21 isoform 2 [Theobroma cacao] gi|508725315|gb|EOY17212.1| 50S ribosomal protein L21 isoform 2 [Theobroma cacao] Length = 256 Score = 53.1 bits (126), Expect = 6e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -3 Query: 368 QVQKEEKLPKKYWTQTAYYKDKSNKHHWIPRLT 270 QVQ+EEKL +KYWT TA Y DK N+HH +PRL+ Sbjct: 188 QVQEEEKLSEKYWTSTAEYADKDNRHHRLPRLS 220 >emb|CDP08407.1| unnamed protein product [Coffea canephora] Length = 211 Score = 52.8 bits (125), Expect = 6e-06 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -1 Query: 334 IGHRQPITRIRVTSITGYQDSPAVTLP 254 IGHRQPITRIR+ ITGY+DSPAVTLP Sbjct: 185 IGHRQPITRIRIMGITGYEDSPAVTLP 211