BLASTX nr result
ID: Rehmannia27_contig00002051
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00002051 (746 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 77 4e-15 gb|EYU35473.1| hypothetical protein MIMGU_mgv11b021317mg [Erythr... 62 2e-09 gb|EYU41120.1| hypothetical protein MIMGU_mgv11b021666mg, partia... 57 1e-07 gb|AAA84681.1| unknown protein (chloroplast) [Nicotiana tabacum]... 49 5e-06 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 77.4 bits (189), Expect = 4e-15 Identities = 43/71 (60%), Positives = 48/71 (67%), Gaps = 8/71 (11%) Frame = +3 Query: 24 MKVDYLSVYFQTSIIPSRTKHESFDSFGSHAQLLRVNSHSFFL*M**AY--------PLF 179 MKVDY S+ FQ SIIPSRTKHESFDSFGSHAQLL+VNSH FF Y LF Sbjct: 1 MKVDYFSIPFQNSIIPSRTKHESFDSFGSHAQLLKVNSHIFF------YECNEPIFSSLF 54 Query: 180 FFQSPKKTNLM 212 FQ +TN++ Sbjct: 55 IFQKDIETNVI 65 >gb|EYU35473.1| hypothetical protein MIMGU_mgv11b021317mg [Erythranthe guttata] Length = 70 Score = 62.0 bits (149), Expect = 2e-09 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +3 Query: 24 MKVDYLSVYFQTSIIPSRTKHESFDSFGSHAQLLRVNS 137 MKVDYL V+F+ SIIPSRTKHES DSFGSH QLLR S Sbjct: 1 MKVDYLFVHFKASIIPSRTKHESKDSFGSHVQLLRCKS 38 >gb|EYU41120.1| hypothetical protein MIMGU_mgv11b021666mg, partial [Erythranthe guttata] Length = 71 Score = 57.4 bits (137), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 39 LSVYFQTSIIPSRTKHESFDSFGSHAQLLR 128 LSV+F+TSIIPSRTKHESFD FGSHAQLLR Sbjct: 13 LSVHFKTSIIPSRTKHESFDLFGSHAQLLR 42 >gb|AAA84681.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224350|prf||1102209D ORF 4 Length = 64 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -3 Query: 294 EEKKRNNFADNYIFLILSEESSKYFCFALDS 202 ++KKRNNFADNYIF ILSEESS+YF L S Sbjct: 17 KKKKRNNFADNYIFFILSEESSEYFGITLVS 47 Score = 30.0 bits (66), Expect(2) = 5e-06 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 197 FWTLKKEERIGSLHS 153 FW + KEE+IGSLHS Sbjct: 50 FWNMNKEEKIGSLHS 64