BLASTX nr result
ID: Rehmannia27_contig00001873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00001873 (712 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827978.1| PREDICTED: uncharacterized protein LOC105949... 65 3e-09 ref|XP_012847871.1| PREDICTED: methyl-CpG-binding domain-contain... 62 3e-09 ref|XP_012847870.1| PREDICTED: methyl-CpG-binding domain-contain... 62 3e-09 >ref|XP_012827978.1| PREDICTED: uncharacterized protein LOC105949229 [Erythranthe guttata] gi|848928976|ref|XP_012827979.1| PREDICTED: uncharacterized protein LOC105949229 [Erythranthe guttata] Length = 203 Score = 64.7 bits (156), Expect = 3e-09 Identities = 31/66 (46%), Positives = 39/66 (59%), Gaps = 10/66 (15%) Frame = +3 Query: 198 EPSRTEERMGDGSGETSS----------GPAKKLTKRRVSDDDSWMPEGWVKKVSQRPQK 347 +P + ER+G+ S G KK TK+ DDDSWMPEGWVK+V++RP Sbjct: 95 QPHKERERVGERSAMPCGPSKQKKAKLGGATKKPTKKTEEDDDSWMPEGWVKRVNKRPLT 154 Query: 348 GKFPGY 365 GKFPGY Sbjct: 155 GKFPGY 160 >ref|XP_012847871.1| PREDICTED: methyl-CpG-binding domain-containing protein 6-like isoform X2 [Erythranthe guttata] Length = 95 Score = 62.0 bits (149), Expect = 3e-09 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 252 GPAKKLTKRRVSDDDSWMPEGWVKKVSQRPQKGKFPGY 365 G KK TK+ DDDSWMPEGWVK+V++RP GKFPGY Sbjct: 15 GATKKPTKKTEVDDDSWMPEGWVKRVNKRPLTGKFPGY 52 >ref|XP_012847870.1| PREDICTED: methyl-CpG-binding domain-containing protein 6-like isoform X1 [Erythranthe guttata] Length = 98 Score = 62.0 bits (149), Expect = 3e-09 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 252 GPAKKLTKRRVSDDDSWMPEGWVKKVSQRPQKGKFPGY 365 G KK TK+ DDDSWMPEGWVK+V++RP GKFPGY Sbjct: 15 GATKKPTKKTEVDDDSWMPEGWVKRVNKRPLTGKFPGY 52