BLASTX nr result
ID: Rehmannia27_contig00001820
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00001820 (606 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW49855.1| hypothetical protein EUGRSUZ_K03324 [Eucalyptus g... 59 5e-07 ref|XP_008777015.1| PREDICTED: uncharacterized protein LOC103697... 58 1e-06 ref|XP_011079921.1| PREDICTED: uncharacterized protein LOC105163... 56 7e-06 >gb|KCW49855.1| hypothetical protein EUGRSUZ_K03324 [Eucalyptus grandis] Length = 347 Score = 58.9 bits (141), Expect = 5e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 515 KTFWLSVVLWPPSACPVLYPLPLYGEASNH 604 K W SVVLWPPSA P+LYP+PLYGEASNH Sbjct: 2 KATWFSVVLWPPSASPMLYPMPLYGEASNH 31 >ref|XP_008777015.1| PREDICTED: uncharacterized protein LOC103697031 [Phoenix dactylifera] gi|672197255|ref|XP_008777016.1| PREDICTED: uncharacterized protein LOC103697031 [Phoenix dactylifera] Length = 355 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +2 Query: 503 PVYTKTFWLSVVLWPPSACPVLYPLPLYGEASNH 604 P + LSVVLWPPSACP LYP+P+YGEASNH Sbjct: 15 PPFFLNLSLSVVLWPPSACPFLYPMPIYGEASNH 48 >ref|XP_011079921.1| PREDICTED: uncharacterized protein LOC105163313 [Sesamum indicum] Length = 542 Score = 55.8 bits (133), Expect = 7e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +2 Query: 533 VVLWPPSACPVLYPLPLYGEASNH 604 VVLWPPSACP LYPLPLYGEASNH Sbjct: 208 VVLWPPSACPYLYPLPLYGEASNH 231