BLASTX nr result
ID: Rehmannia27_contig00001295
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00001295 (373 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082908.1| PREDICTED: pentatricopeptide repeat-containi... 73 9e-13 ref|XP_012846716.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-09 >ref|XP_011082908.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, chloroplastic [Sesamum indicum] Length = 520 Score = 73.2 bits (178), Expect = 9e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 102 MPPCFLSFNPPSTSISKFISDQPFLSMLETNCHS 1 MPPCF SFNPPSTSISKFISDQPFLSMLETNCH+ Sbjct: 1 MPPCFCSFNPPSTSISKFISDQPFLSMLETNCHT 34 >ref|XP_012846716.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, chloroplastic [Erythranthe guttata] Length = 611 Score = 64.3 bits (155), Expect = 1e-09 Identities = 32/44 (72%), Positives = 34/44 (77%), Gaps = 3/44 (6%) Frame = -2 Query: 123 KVNIYPR---MPPCFLSFNPPSTSISKFISDQPFLSMLETNCHS 1 KV YP PPCF S NP STSISKFISDQPFLS+LETNCH+ Sbjct: 80 KVGGYPIPSIKPPCFCSSNPASTSISKFISDQPFLSLLETNCHT 123