BLASTX nr result
ID: Rehmannia27_contig00001107
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00001107 (759 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20982.1| hypothetical protein MIMGU_mgv1a011603mg [Erythra... 61 1e-07 ref|XP_012857113.1| PREDICTED: wiskott-Aldrich syndrome protein ... 61 1e-07 ref|XP_011087410.1| PREDICTED: uncharacterized protein LOC105168... 57 5e-06 emb|CDP19532.1| unnamed protein product [Coffea canephora] 57 6e-06 >gb|EYU20982.1| hypothetical protein MIMGU_mgv1a011603mg [Erythranthe guttata] Length = 276 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 759 VEYQIRTPSGKSKGSIKFSCRFGEKFTHQVEEKKHVASEPVT 634 VEYQ+ TPSGKSKGS+KFS +FGEKF +VE K+HV +PVT Sbjct: 114 VEYQLHTPSGKSKGSLKFSYQFGEKFKQEVEAKRHV-DDPVT 154 >ref|XP_012857113.1| PREDICTED: wiskott-Aldrich syndrome protein family member 2-like [Erythranthe guttata] Length = 286 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 759 VEYQIRTPSGKSKGSIKFSCRFGEKFTHQVEEKKHVASEPVT 634 VEYQ+ TPSGKSKGS+KFS +FGEKF +VE K+HV +PVT Sbjct: 114 VEYQLHTPSGKSKGSLKFSYQFGEKFKQEVEAKRHV-DDPVT 154 >ref|XP_011087410.1| PREDICTED: uncharacterized protein LOC105168911 [Sesamum indicum] Length = 345 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -1 Query: 759 VEYQIRTPSGKSKGSIKFSCRFGEKFTHQVEEKKHVASEPVT 634 VEYQ+ T SGK KG++KFS RFGEKFTHQ+E K+ +PVT Sbjct: 175 VEYQVHTRSGKPKGTLKFSYRFGEKFTHQMEAKR--TDDPVT 214 >emb|CDP19532.1| unnamed protein product [Coffea canephora] Length = 288 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -1 Query: 759 VEYQIRTPSGKSKGSIKFSCRFGEKFTHQVEEKKHVASEPVT 634 +EYQ+RT SGK KG+IKFS +FGEKF + E KK EPVT Sbjct: 118 LEYQVRTSSGKPKGTIKFSYKFGEKFKQEAEAKKKNVGEPVT 159